UniProt ID | RL5B_SCHPO | |
---|---|---|
UniProt AC | O74306 | |
Protein Name | 60S ribosomal protein L5-B | |
Gene Name | rpl502 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 294 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.. | |
Protein Sequence | MPFIKAVKSSPYFSRYQTKYRRRREGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYVLAHAHSSELPRYGIKWGLANWTAAYATGLLVARRALAKVGLADKYEGVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAMKGASDGGLFIPHSPNRFPGFDIETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQFSGLIADGIESDQLEDIYAEAYAKIREDPSFQKSGKDAAAFKAESLKYTQRKLTAEERKERFNAKVIEAGRA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | PFIKAVKSSPYFSRY CCCHHHHCCCCCHHH | 29.91 | 28889911 | |
10 | Phosphorylation | FIKAVKSSPYFSRYQ CCHHHHCCCCCHHHH | 20.22 | 28889911 | |
12 | Phosphorylation | KAVKSSPYFSRYQTK HHHHCCCCCHHHHHH | 19.01 | 28889911 | |
67 | Phosphorylation | VTCQIVSSRVNGDYV EEEEEEECCCCCCEE | 29.38 | 25720772 | |
73 | Phosphorylation | SSRVNGDYVLAHAHS ECCCCCCEEEEEEEC | 9.96 | 25720772 | |
81 | Phosphorylation | VLAHAHSSELPRYGI EEEEEECCCCCCCCH | 33.03 | 28889911 | |
123 | Phosphorylation | ADKYEGVTEPEGEFE CCCCCCCCCCCCEEE | 57.59 | 21712547 | |
132 | Phosphorylation | PEGEFELTEAIEDGP CCCEEEEEHHHCCCC | 19.04 | 24763107 | |
153 | Phosphorylation | LDVGLKRTSTGSRVF EEECEEECCCCCHHH | 29.11 | 24763107 | |
157 | Phosphorylation | LKRTSTGSRVFGAMK EEECCCCCHHHCCCC | 25.92 | 27738172 | |
167 | Phosphorylation | FGAMKGASDGGLFIP HCCCCCCCCCCEECC | 45.52 | 28889911 | |
176 | Phosphorylation | GGLFIPHSPNRFPGF CCEECCCCCCCCCCC | 20.65 | 28889911 | |
187 | Phosphorylation | FPGFDIETEELDDET CCCCCCCCCCCCHHH | 34.78 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL5B_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL5B_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL5B_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL5B_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...