UniProt ID | RL38_MOUSE | |
---|---|---|
UniProt AC | Q9JJI8 | |
Protein Name | 60S ribosomal protein L38 | |
Gene Name | Rpl38 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 70 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSRYLYTLVITDKEKAEKLKQSLPPGLAVKDLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Ubiquitination | ----MPRKIEEIKDF ----CCCCHHHHHHH | 48.91 | - | |
4 | Acetylation | ----MPRKIEEIKDF ----CCCCHHHHHHH | 48.91 | 22826441 | |
9 | Acetylation | PRKIEEIKDFLLTAR CCCHHHHHHHHHHHH | 45.79 | 23201123 | |
9 | Succinylation | PRKIEEIKDFLLTAR CCCHHHHHHHHHHHH | 45.79 | 23954790 | |
9 | Malonylation | PRKIEEIKDFLLTAR CCCHHHHHHHHHHHH | 45.79 | 26073543 | |
9 | Ubiquitination | PRKIEEIKDFLLTAR CCCHHHHHHHHHHHH | 45.79 | - | |
29 | Acetylation | SVKIKKNKDNVKFKV CCEEECCCCCCEEEE | 60.61 | 23201123 | |
39 | Phosphorylation | VKFKVRCSRYLYTLV CEEEEEECEEEEEEE | 17.25 | 18266315 | |
41 | Phosphorylation | FKVRCSRYLYTLVIT EEEEECEEEEEEEEC | 6.43 | 18266315 | |
43 | Phosphorylation | VRCSRYLYTLVITDK EEECEEEEEEEECCH | 6.79 | 25159016 | |
44 | Phosphorylation | RCSRYLYTLVITDKE EECEEEEEEEECCHH | 16.38 | 25159016 | |
50 | Ubiquitination | YTLVITDKEKAEKLK EEEEECCHHHHHHHH | 53.09 | - | |
50 | Acetylation | YTLVITDKEKAEKLK EEEEECCHHHHHHHH | 53.09 | 23954790 | |
52 | Acetylation | LVITDKEKAEKLKQS EEECCHHHHHHHHHH | 68.53 | 23201123 | |
52 | Malonylation | LVITDKEKAEKLKQS EEECCHHHHHHHHHH | 68.53 | 26073543 | |
55 | Acetylation | TDKEKAEKLKQSLPP CCHHHHHHHHHHCCC | 66.88 | 23201123 | |
67 | Acetylation | LPPGLAVKDLK---- CCCCCCCCCCC---- | 52.30 | 23864654 | |
67 | Ubiquitination | LPPGLAVKDLK---- CCCCCCCCCCC---- | 52.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL38_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL38_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL38_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL38_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...