RL37A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL37A_SCHPO
• UniProt AC: P59289
• Protein Name: 60S ribosomal protein L37-A
• Gene Name: rpl3703
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 89
• Protein Description: Binds to the 23S rRNA..
• Protein Sequence: MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGFRAGKPTSAATA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTKGTQSFG ------CCCCCCCCC	37.88	29996109
26	Phosphorylation	CRRCGKRSFHIQKST HHHCCCCEEEECCCC	25.35	25720772
32	Phosphorylation	RSFHIQKSTCACCGY CEEEECCCCCCCCCC	16.61	25720772
33	Phosphorylation	SFHIQKSTCACCGYP EEEECCCCCCCCCCC	15.91	25720772
44	Phosphorylation	CGYPAAKTRSYNWGA CCCCCCHHCCCCCCC	21.81	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL37A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL37A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL37A_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL37A_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.