RL36B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL36B_SCHPO
• UniProt AC: O94658
• Protein Name: 60S ribosomal protein L36-B
• Gene Name: rpl3602
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 99
• Protein Sequence: MAPGLVVGLNKGKTLTKRQLPERPSRRKGHLSKRTAFVRSIVREVAGFAPYERRVMELIRNSQDKRARKLAKKRLGTLKRAKGKIEELTSVIQSSRLAH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	VMELIRNSQDKRARK HHHHHHCCHHHHHHH	29.88	25720772
89	Phosphorylation	KGKIEELTSVIQSSR HHHHHHHHHHHHHHH	24.99	21712547
94	Phosphorylation	ELTSVIQSSRLAH-- HHHHHHHHHHCCC--	13.29	25720772
95	Phosphorylation	LTSVIQSSRLAH--- HHHHHHHHHCCC---	18.22	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL36B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL36B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL36B_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL36B_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.