UniProt ID | RL35A_MOUSE | |
---|---|---|
UniProt AC | O55142 | |
Protein Name | 60S ribosomal protein L35a | |
Gene Name | Rpl35a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 110 | |
Subcellular Localization | ||
Protein Description | Required for the proliferation and viability of hematopoietic cells. Plays a role in 60S ribosomal subunit formation. The protein was found to bind to both initiator and elongator tRNAs and consequently was assigned to the P site or P and A site.. | |
Protein Sequence | MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGRLWCKA ------CCCCHHHHH | 32.40 | 22324799 | |
8 | Acetylation | MSGRLWCKAIFAGYK CCCCHHHHHHHHHHH | 32.70 | 22826441 | |
14 | Phosphorylation | CKAIFAGYKRGLRNQ HHHHHHHHHHHHCCC | 8.29 | - | |
15 | Acetylation | KAIFAGYKRGLRNQR HHHHHHHHHHHCCCC | 38.79 | 22826441 | |
15 | Ubiquitination | KAIFAGYKRGLRNQR HHHHHHHHHHHCCCC | 38.79 | - | |
15 | Succinylation | KAIFAGYKRGLRNQR HHHHHHHHHHHCCCC | 38.79 | 23954790 | |
29 | Acetylation | REHTALLKIEGVYAR CCCEEEEEEEEEECC | 39.29 | 22826441 | |
34 | Phosphorylation | LLKIEGVYARDETEF EEEEEEEECCCCCEE | 13.53 | - | |
45 | Succinylation | ETEFYLGKRCAYVYK CCEEEECCEEEEEEE | 41.53 | 23954790 | |
45 | Ubiquitination | ETEFYLGKRCAYVYK CCEEEECCEEEEEEE | 41.53 | - | |
49 | Phosphorylation | YLGKRCAYVYKAKNN EECCEEEEEEECCCC | 14.13 | 29514104 | |
54 | Ubiquitination | CAYVYKAKNNTVTPG EEEEEECCCCEECCC | 46.72 | - | |
59 | Phosphorylation | KAKNNTVTPGGKPNK ECCCCEECCCCCCCC | 17.74 | 22802335 | |
63 | Succinylation | NTVTPGGKPNKTRVI CEECCCCCCCCEEEE | 51.86 | - | |
63 | Succinylation | NTVTPGGKPNKTRVI CEECCCCCCCCEEEE | 51.86 | 23806337 | |
63 | Acetylation | NTVTPGGKPNKTRVI CEECCCCCCCCEEEE | 51.86 | 23806337 | |
63 | Ubiquitination | NTVTPGGKPNKTRVI CEECCCCCCCCEEEE | 51.86 | - | |
73 | Acetylation | KTRVIWGKVTRAHGN CEEEEEEEEEECCCC | 25.99 | 22826441 | |
90 | Phosphorylation | MVRAKFRSNLPAKAI CCCHHHHCCCCHHHH | 45.94 | 19854140 | |
95 | Acetylation | FRSNLPAKAIGHRIR HHCCCCHHHHCCEEE | 38.30 | 22826441 | |
95 | Ubiquitination | FRSNLPAKAIGHRIR HHCCCCHHHHCCEEE | 38.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL35A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL35A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL35A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL35A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...