UniProt ID | RL34_MOUSE | |
---|---|---|
UniProt AC | Q9D1R9 | |
Protein Name | 60S ribosomal protein L34 | |
Gene Name | Rpl34 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 117 | |
Subcellular Localization | Cytoplasm, cytosol . Cytoplasm . Endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity). | |
Protein Description | Component of the large ribosomal subunit.. | |
Protein Sequence | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | LTYRRRLSYNTASNK HHHHHHHCCCCCCCC | 17.96 | 26824392 | |
13 | Phosphorylation | TYRRRLSYNTASNKT HHHHHHCCCCCCCCE | 22.56 | 28833060 | |
15 | Phosphorylation | RRRLSYNTASNKTRL HHHHCCCCCCCCEEE | 24.19 | 22802335 | |
17 | Phosphorylation | RLSYNTASNKTRLSR HHCCCCCCCCEEECC | 36.50 | 28833060 | |
19 | Acetylation | SYNTASNKTRLSRTP CCCCCCCCEEECCCC | 32.31 | 23806337 | |
19 | Succinylation | SYNTASNKTRLSRTP CCCCCCCCEEECCCC | 32.31 | 23806337 | |
19 | Ubiquitination | SYNTASNKTRLSRTP CCCCCCCCEEECCCC | 32.31 | - | |
23 | Phosphorylation | ASNKTRLSRTPGNRI CCCCEEECCCCCCEE | 30.71 | 29514104 | |
25 | Phosphorylation | NKTRLSRTPGNRIVY CCEEECCCCCCEEEE | 31.97 | 26824392 | |
32 | Phosphorylation | TPGNRIVYLYTKKVG CCCCEEEEEEECCCC | 7.51 | 20139300 | |
34 | Phosphorylation | GNRIVYLYTKKVGKA CCEEEEEEECCCCCC | 9.99 | 26824392 | |
36 | Ubiquitination | RIVYLYTKKVGKAPK EEEEEEECCCCCCCH | 31.72 | - | |
36 | Acetylation | RIVYLYTKKVGKAPK EEEEEEECCCCCCCH | 31.72 | 22826441 | |
36 | Succinylation | RIVYLYTKKVGKAPK EEEEEEECCCCCCCH | 31.72 | 23954790 | |
43 | Acetylation | KKVGKAPKSACGVCP CCCCCCCHHHCCCCC | 56.39 | 23806337 | |
43 | Succinylation | KKVGKAPKSACGVCP CCCCCCCHHHCCCCC | 56.39 | 23806337 | |
44 | Phosphorylation | KVGKAPKSACGVCPG CCCCCCHHHCCCCCC | 27.94 | 25521595 | |
46 | S-palmitoylation | GKAPKSACGVCPGRL CCCCHHHCCCCCCCC | 5.61 | 28526873 | |
46 | Glutathionylation | GKAPKSACGVCPGRL CCCCHHHCCCCCCCC | 5.61 | 24333276 | |
49 | Glutathionylation | PKSACGVCPGRLRGV CHHHCCCCCCCCCCC | 1.47 | 24333276 | |
49 | S-palmitoylation | PKSACGVCPGRLRGV CHHHCCCCCCCCCCC | 1.47 | 28526873 | |
68 | Phosphorylation | PKVLMRLSKTQKHVS HHHHHHHHHHHHHHH | 24.24 | 29176673 | |
83 | Glutathionylation | RAYGGSMCAKCVRDR HHHCCCHHHHHHHHH | 3.33 | 24333276 | |
83 | S-palmitoylation | RAYGGSMCAKCVRDR HHHCCCHHHHHHHHH | 3.33 | 28526873 | |
85 | Acetylation | YGGSMCAKCVRDRIK HCCCHHHHHHHHHHH | 28.47 | 22826441 | |
86 | Glutathionylation | GGSMCAKCVRDRIKR CCCHHHHHHHHHHHH | 1.29 | 24333276 | |
101 | Ubiquitination | AFLIEEQKIVVKVLK HHCCCHHHHHHHHHH | 40.52 | - | |
105 | Malonylation | EEQKIVVKVLKAQAQ CHHHHHHHHHHHHHH | 30.84 | 26320211 | |
105 | Acetylation | EEQKIVVKVLKAQAQ CHHHHHHHHHHHHHH | 30.84 | 23201123 | |
105 | Ubiquitination | EEQKIVVKVLKAQAQ CHHHHHHHHHHHHHH | 30.84 | - | |
108 | Malonylation | KIVVKVLKAQAQSQK HHHHHHHHHHHHHHH | 41.25 | 26320211 | |
108 | Ubiquitination | KIVVKVLKAQAQSQK HHHHHHHHHHHHHHH | 41.25 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL34_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL34_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL34_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL34_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...