| UniProt ID | RL34_MOUSE | |
|---|---|---|
| UniProt AC | Q9D1R9 | |
| Protein Name | 60S ribosomal protein L34 | |
| Gene Name | Rpl34 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 117 | |
| Subcellular Localization | Cytoplasm, cytosol . Cytoplasm . Endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity). | |
| Protein Description | Component of the large ribosomal subunit.. | |
| Protein Sequence | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Phosphorylation | LTYRRRLSYNTASNK HHHHHHHCCCCCCCC | 17.96 | 26824392 | |
| 13 | Phosphorylation | TYRRRLSYNTASNKT HHHHHHCCCCCCCCE | 22.56 | 28833060 | |
| 15 | Phosphorylation | RRRLSYNTASNKTRL HHHHCCCCCCCCEEE | 24.19 | 22802335 | |
| 17 | Phosphorylation | RLSYNTASNKTRLSR HHCCCCCCCCEEECC | 36.50 | 28833060 | |
| 19 | Acetylation | SYNTASNKTRLSRTP CCCCCCCCEEECCCC | 32.31 | 23806337 | |
| 19 | Succinylation | SYNTASNKTRLSRTP CCCCCCCCEEECCCC | 32.31 | 23806337 | |
| 19 | Ubiquitination | SYNTASNKTRLSRTP CCCCCCCCEEECCCC | 32.31 | - | |
| 23 | Phosphorylation | ASNKTRLSRTPGNRI CCCCEEECCCCCCEE | 30.71 | 29514104 | |
| 25 | Phosphorylation | NKTRLSRTPGNRIVY CCEEECCCCCCEEEE | 31.97 | 26824392 | |
| 32 | Phosphorylation | TPGNRIVYLYTKKVG CCCCEEEEEEECCCC | 7.51 | 20139300 | |
| 34 | Phosphorylation | GNRIVYLYTKKVGKA CCEEEEEEECCCCCC | 9.99 | 26824392 | |
| 36 | Ubiquitination | RIVYLYTKKVGKAPK EEEEEEECCCCCCCH | 31.72 | - | |
| 36 | Acetylation | RIVYLYTKKVGKAPK EEEEEEECCCCCCCH | 31.72 | 22826441 | |
| 36 | Succinylation | RIVYLYTKKVGKAPK EEEEEEECCCCCCCH | 31.72 | 23954790 | |
| 43 | Acetylation | KKVGKAPKSACGVCP CCCCCCCHHHCCCCC | 56.39 | 23806337 | |
| 43 | Succinylation | KKVGKAPKSACGVCP CCCCCCCHHHCCCCC | 56.39 | 23806337 | |
| 44 | Phosphorylation | KVGKAPKSACGVCPG CCCCCCHHHCCCCCC | 27.94 | 25521595 | |
| 46 | S-palmitoylation | GKAPKSACGVCPGRL CCCCHHHCCCCCCCC | 5.61 | 28526873 | |
| 46 | Glutathionylation | GKAPKSACGVCPGRL CCCCHHHCCCCCCCC | 5.61 | 24333276 | |
| 49 | Glutathionylation | PKSACGVCPGRLRGV CHHHCCCCCCCCCCC | 1.47 | 24333276 | |
| 49 | S-palmitoylation | PKSACGVCPGRLRGV CHHHCCCCCCCCCCC | 1.47 | 28526873 | |
| 68 | Phosphorylation | PKVLMRLSKTQKHVS HHHHHHHHHHHHHHH | 24.24 | 29176673 | |
| 83 | Glutathionylation | RAYGGSMCAKCVRDR HHHCCCHHHHHHHHH | 3.33 | 24333276 | |
| 83 | S-palmitoylation | RAYGGSMCAKCVRDR HHHCCCHHHHHHHHH | 3.33 | 28526873 | |
| 85 | Acetylation | YGGSMCAKCVRDRIK HCCCHHHHHHHHHHH | 28.47 | 22826441 | |
| 86 | Glutathionylation | GGSMCAKCVRDRIKR CCCHHHHHHHHHHHH | 1.29 | 24333276 | |
| 101 | Ubiquitination | AFLIEEQKIVVKVLK HHCCCHHHHHHHHHH | 40.52 | - | |
| 105 | Malonylation | EEQKIVVKVLKAQAQ CHHHHHHHHHHHHHH | 30.84 | 26320211 | |
| 105 | Acetylation | EEQKIVVKVLKAQAQ CHHHHHHHHHHHHHH | 30.84 | 23201123 | |
| 105 | Ubiquitination | EEQKIVVKVLKAQAQ CHHHHHHHHHHHHHH | 30.84 | - | |
| 108 | Malonylation | KIVVKVLKAQAQSQK HHHHHHHHHHHHHHH | 41.25 | 26320211 | |
| 108 | Ubiquitination | KIVVKVLKAQAQSQK HHHHHHHHHHHHHHH | 41.25 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL34_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL34_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL34_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RL34_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...