RL34A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL34A_SCHPO
• UniProt AC: O42846
• Protein Name: 60S ribosomal protein L34-A
• Gene Name: rpl3401
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 112
• Protein Sequence: MAQRVTYRRRLAYNTRSNRTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPREFARLSHNKKTVQRAYGGCLSANAVKDRIVRAFLIEEQKIVKQKLKQLSSQK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	NRTRIIKTPGNNIRY CCEEEEECCCCCEEE	26.48	24763107
76	Phosphorylation	KKTVQRAYGGCLSAN HHHHHHHHCCCCCHH	19.08	28889911
110	Phosphorylation	QKLKQLSSQK----- HHHHHHHCCC-----	51.05	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL34A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL34A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL34A_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.