UniProt ID | RL33B_SCHPO | |
---|---|---|
UniProt AC | Q9USG6 | |
Protein Name | 60S ribosomal protein L33-B | |
Gene Name | rpl35a | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 108 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPAQGHRLYVKAKHLSFQRSKHVIHPGTSIVKIEGCDSKEEAQFYLGKRVCYVYKSSKAVRGSKIRVIWGTIARPHGNSGAVRARFVHNLPAKTFGSSLRVMLYPSNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | YVKAKHLSFQRSKHV EEEEEEECEECCCCE | 21.03 | 25720772 | |
56 | Phosphorylation | RVCYVYKSSKAVRGS EEEEEEECCCCCCCC | 21.27 | 28889911 | |
57 | Phosphorylation | VCYVYKSSKAVRGSK EEEEEECCCCCCCCC | 22.08 | 28889911 | |
63 | Phosphorylation | SSKAVRGSKIRVIWG CCCCCCCCCEEEEEE | 17.85 | 28889911 | |
97 | Phosphorylation | LPAKTFGSSLRVMLY CCCCCCCCEEEEEEC | 23.24 | 25720772 | |
98 | Phosphorylation | PAKTFGSSLRVMLYP CCCCCCCEEEEEECC | 22.15 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL33B_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL33B_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL33B_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL33B_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...