RL32B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL32B_SCHPO
• UniProt AC: O42935
• Protein Name: 60S ribosomal protein L32-B
• Gene Name: rpl3201
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 127
• Protein Sequence: MAAINIVKKRTKPFKRHQSDLFKRVGESWRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMPNGLKAFLVRNVSDVELLLMHNKTYAAEIASNVSARKRVEIVEKARALGVKVTNAGAKVRSQE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	KPFKRHQSDLFKRVG CCCHHHHHHHHHHHH	30.10	28889911
77	Phosphorylation	AFLVRNVSDVELLLM EEEEECCCHHHHHHH	39.22	28889911
95	Phosphorylation	TYAAEIASNVSARKR CHHHHHHHCCCHHHH	43.35	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL32B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL32B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL32B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RL32A_SCHPO	rpl3202	genetic	23577148
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.