UniProt ID | RL32B_SCHPO | |
---|---|---|
UniProt AC | O42935 | |
Protein Name | 60S ribosomal protein L32-B | |
Gene Name | rpl3201 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 127 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAAINIVKKRTKPFKRHQSDLFKRVGESWRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMPNGLKAFLVRNVSDVELLLMHNKTYAAEIASNVSARKRVEIVEKARALGVKVTNAGAKVRSQE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | KPFKRHQSDLFKRVG CCCHHHHHHHHHHHH | 30.10 | 28889911 | |
77 | Phosphorylation | AFLVRNVSDVELLLM EEEEECCCHHHHHHH | 39.22 | 28889911 | |
95 | Phosphorylation | TYAAEIASNVSARKR CHHHHHHHCCCHHHH | 43.35 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL32B_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL32B_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL32B_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RL32A_SCHPO | rpl3202 | genetic | 23577148 | |
YGNB_SCHPO | nap2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...