UniProt ID | RL29_MOUSE | |
---|---|---|
UniProt AC | P47915 | |
Protein Name | 60S ribosomal protein L29 | |
Gene Name | Rpl29 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 160 | |
Subcellular Localization | ||
Protein Description | Component of the large ribosomal subunit.. | |
Protein Sequence | MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGKRIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Methylation | ---MAKSKNHTTHNQ ---CCCCCCCCCCHH | 52.63 | - | |
26 | Phosphorylation | NGIKKPRSQRYESLK CCCCCCHHHHHHHHC | 27.77 | 29176673 | |
29 | Phosphorylation | KKPRSQRYESLKGVD CCCHHHHHHHHCCCC | 11.39 | 28066266 | |
31 | Phosphorylation | PRSQRYESLKGVDPK CHHHHHHHHCCCCHH | 26.84 | 26824392 | |
33 | Acetylation | SQRYESLKGVDPKFL HHHHHHHCCCCHHHH | 67.19 | - | |
33 | Ubiquitination | SQRYESLKGVDPKFL HHHHHHHCCCCHHHH | 67.19 | - | |
38 | Ubiquitination | SLKGVDPKFLRNMRF HHCCCCHHHHHHHHH | 53.20 | 22790023 | |
63 | Malonylation | KMQANNAKAVSARAE HHHHCCHHHHHHHHH | 51.98 | 26320211 | |
63 | Ubiquitination | KMQANNAKAVSARAE HHHHCCHHHHHHHHH | 51.98 | - | |
66 | Phosphorylation | ANNAKAVSARAEAIK HCCHHHHHHHHHHHH | 19.52 | 22817900 | |
73 | Malonylation | SARAEAIKALVKPQA HHHHHHHHHHHCHHH | 42.59 | 32601280 | |
73 | Ubiquitination | SARAEAIKALVKPQA HHHHHHHHHHHCHHH | 42.59 | 22790023 | |
77 | Ubiquitination | EAIKALVKPQAIKPK HHHHHHHCHHHCCCC | 32.06 | - | |
77 | Acetylation | EAIKALVKPQAIKPK HHHHHHHCHHHCCCC | 32.06 | 23201123 | |
82 | Ubiquitination | LVKPQAIKPKMPKGP HHCHHHCCCCCCCCH | 41.42 | - | |
82 | Acetylation | LVKPQAIKPKMPKGP HHCHHHCCCCCCCCH | 41.42 | 23864654 | |
84 | Acetylation | KPQAIKPKMPKGPKL CHHHCCCCCCCCHHH | 63.93 | 23864654 | |
101 | Acetylation | LAFIAHPKLGKRIRS HEEECCHHHHHHHHH | 61.06 | 23806337 | |
101 | Ubiquitination | LAFIAHPKLGKRIRS HEEECCHHHHHHHHH | 61.06 | 22790023 | |
108 | Phosphorylation | KLGKRIRSYMAKGQR HHHHHHHHHHHHCCC | 19.52 | 29176673 | |
112 | Succinylation | RIRSYMAKGQRLCQP HHHHHHHHCCCCCCC | 38.76 | 23806337 | |
112 | Acetylation | RIRSYMAKGQRLCQP HHHHHHHHCCCCCCC | 38.76 | 23806337 | |
117 | Glutathionylation | MAKGQRLCQPKPKVQ HHHCCCCCCCCCCCC | 7.68 | 24333276 | |
117 | S-nitrosylation | MAKGQRLCQPKPKVQ HHHCCCCCCCCCCCC | 7.68 | 21278135 | |
117 | S-nitrosocysteine | MAKGQRLCQPKPKVQ HHHCCCCCCCCCCCC | 7.68 | - | |
125 | Phosphorylation | QPKPKVQTKAGAKAP CCCCCCCCCCCCCCC | 26.33 | 23649490 | |
134 | Malonylation | AGAKAPAKAQASAPA CCCCCCCHHHCCCCC | 39.72 | 26320211 | |
134 | Ubiquitination | AGAKAPAKAQASAPA CCCCCCCHHHCCCCC | 39.72 | - | |
134 | Acetylation | AGAKAPAKAQASAPA CCCCCCCHHHCCCCC | 39.72 | 23806337 | |
138 | Phosphorylation | APAKAQASAPAQAPK CCCHHHCCCCCCCCC | 23.78 | 26824392 | |
145 | Malonylation | SAPAQAPKGAQAPKG CCCCCCCCCCCCCCC | 70.65 | 26320211 | |
145 | Acetylation | SAPAQAPKGAQAPKG CCCCCCCCCCCCCCC | 70.65 | 23806337 | |
145 | Ubiquitination | SAPAQAPKGAQAPKG CCCCCCCCCCCCCCC | 70.65 | - | |
151 | Malonylation | PKGAQAPKGAQAPVK CCCCCCCCCCCCCCC | 70.65 | 26320211 | |
151 | Acetylation | PKGAQAPKGAQAPVK CCCCCCCCCCCCCCC | 70.65 | 23806337 | |
151 | Ubiquitination | PKGAQAPKGAQAPVK CCCCCCCCCCCCCCC | 70.65 | - | |
158 | Malonylation | KGAQAPVKAP----- CCCCCCCCCC----- | 54.61 | 26320211 | |
158 | Ubiquitination | KGAQAPVKAP----- CCCCCCCCCC----- | 54.61 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL29_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL29_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL29_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL29_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...