RL28A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL28A_SCHPO
• UniProt AC: P36585
• Protein Name: 60S ribosomal protein L28-A
• Gene Name: rpl2802
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 148
• Protein Sequence: MPTHVSKTRKLRGHVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHPGYFGKVGMRRFHLMKNPLWRPTVNLDRLWTLLPNEARDKYLGKNTEVAPVINVLQSGYGKVLGKGRLPETPVIVQTRYVSRRAEEKIKQAGGVVELIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
95	Phosphorylation	DKYLGKNTEVAPVIN HHHCCCCCCHHHHHH	35.01	25720772
106	Phosphorylation	PVINVLQSGYGKVLG HHHHHHHCCCCCCCC	29.80	25720772
108	Phosphorylation	INVLQSGYGKVLGKG HHHHHCCCCCCCCCC	21.01	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL28A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL28A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL28A_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL28A_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.