UniProt ID | RL27A_RAT | |
---|---|---|
UniProt AC | P18445 | |
Protein Name | 60S ribosomal protein L27a | |
Gene Name | Rpl27a | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 148 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKNGVAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Hydroxylation | RGNAGGMHHHRINFD CCCCCCCCCCCCCCC | 19.51 | - | |
47 | Acetylation | HHRINFDKYHPGYFG CCCCCCCCCCCCCCC | 41.12 | 22902405 | |
55 | Acetylation | YHPGYFGKVGMRHYH CCCCCCCCCCCCCCC | 26.22 | 22902405 | |
68 | Phosphorylation | YHLKRNQSFCPTVNL CCCCCCCCCCCCCCH | 32.15 | 27097102 | |
72 | Phosphorylation | RNQSFCPTVNLDKLW CCCCCCCCCCHHHHH | 24.17 | 23984901 | |
80 | Phosphorylation | VNLDKLWTLVSEQTR CCHHHHHHHHCHHHH | 27.93 | 23984901 | |
83 | Phosphorylation | DKLWTLVSEQTRVNA HHHHHHHCHHHHHHH | 27.40 | 23984901 | |
86 | Phosphorylation | WTLVSEQTRVNAAKN HHHHCHHHHHHHHHH | 32.31 | 23984901 | |
106 | Phosphorylation | PIIDVVRSGYYKVLG CHHHHHHHCCEEECC | 21.38 | 23984901 | |
108 | Phosphorylation | IDVVRSGYYKVLGKG HHHHHHCCEEECCCC | 11.02 | 23984901 | |
109 | Phosphorylation | DVVRSGYYKVLGKGK HHHHHCCEEECCCCC | 9.72 | 23984901 | |
110 | Acetylation | VVRSGYYKVLGKGKL HHHHCCEEECCCCCC | 23.62 | - | |
125 | Ubiquitination | PKQPVIVKAKFFSRR CCCCEEEEEEECCHH | 34.43 | - | |
127 | Acetylation | QPVIVKAKFFSRRAE CCEEEEEEECCHHHH | 41.02 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL27A_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
39 | H | Hydroxylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL27A_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL27A_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...