UniProt ID | RL27A_MOUSE | |
---|---|---|
UniProt AC | P14115 | |
Protein Name | 60S ribosomal protein L27a | |
Gene Name | Rpl27a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 148 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Hydroxylation | RGNAGGMHHHRINFD CCCCCCCCCCCCCCC | 19.51 | - | |
47 | Acetylation | HHRINFDKYHPGYFG CCCCCCCCCCCCCCC | 41.12 | 23201123 | |
48 | Phosphorylation | HRINFDKYHPGYFGK CCCCCCCCCCCCCCC | 18.32 | 29514104 | |
52 | Phosphorylation | FDKYHPGYFGKVGMR CCCCCCCCCCCCCCC | 17.38 | 25367039 | |
55 | Acetylation | YHPGYFGKVGMRHYH CCCCCCCCCCCCCCC | 26.22 | 22826441 | |
61 | Phosphorylation | GKVGMRHYHLKRNQS CCCCCCCCCCCCCCC | 9.85 | 29514104 | |
68 | Phosphorylation | YHLKRNQSFCPTVNL CCCCCCCCCCCCCCH | 32.15 | 26824392 | |
72 | Phosphorylation | RNQSFCPTVNLDKLW CCCCCCCCCCHHHHH | 24.17 | 28725479 | |
77 | Ubiquitination | CPTVNLDKLWTLVSE CCCCCHHHHHHHHCH | 49.44 | - | |
80 | Phosphorylation | VNLDKLWTLVSEQTR CCHHHHHHHHCHHHH | 27.93 | 28066266 | |
83 | Phosphorylation | DKLWTLVSEQTRVNA HHHHHHHCHHHHHHH | 27.40 | 28066266 | |
86 | Phosphorylation | WTLVSEQTRVNAAKN HHHHCHHHHHHHHHC | 32.31 | 28066266 | |
94 | Succinylation | RVNAAKNKTGVAPII HHHHHHCCCCCCCHH | 46.05 | 23806337 | |
94 | Malonylation | RVNAAKNKTGVAPII HHHHHHCCCCCCCHH | 46.05 | 26320211 | |
94 | Ubiquitination | RVNAAKNKTGVAPII HHHHHHCCCCCCCHH | 46.05 | - | |
94 | Acetylation | RVNAAKNKTGVAPII HHHHHHCCCCCCCHH | 46.05 | 23806337 | |
106 | Phosphorylation | PIIDVVRSGYYKVLG CHHHHHHCCCEEECC | 21.38 | 29514104 | |
110 | Acetylation | VVRSGYYKVLGKGKL HHHCCCEEECCCCCC | 23.62 | 22826441 | |
125 | Ubiquitination | PKQPVIVKAKFFSRR CCCCEEEEEEECCHH | 34.43 | 27667366 | |
127 | Ubiquitination | QPVIVKAKFFSRRAE CCEEEEEEECCHHHH | 41.02 | 27667366 | |
144 | S-nitrosylation | IKGVGGACVLVA--- HCCCCCEEEEEC--- | 2.48 | 22178444 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL27A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
39 | H | Hydroxylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL27A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL27A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...