RL261_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL261_ARATH
• UniProt AC: P51414
• Protein Name: 60S ribosomal protein L26-1
• Gene Name: RPL26A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 146
• Protein Sequence: MKYNPRVTSSRRKNRKAHFTASSSERRVIMSSPLSTDLRQKYNVRSMPIRKDDEVQIVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGTTVNVGIQPSKVVITKLRLDKDRKSLLERKAKGRAAADKEKGTKFTSEDVMQNVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	KNRKAHFTASSSERR CCCCEEEECCHHHCE	18.76	30407730
22	Phosphorylation	RKAHFTASSSERRVI CCEEEECCHHHCEEE	31.19	30407730
23	Phosphorylation	KAHFTASSSERRVIM CEEEECCHHHCEEEE	33.48	30407730
24	Phosphorylation	AHFTASSSERRVIMS EEEECCHHHCEEEEE	32.40	30407730
35	Phosphorylation	VIMSSPLSTDLRQKY EEEECCCCHHHHHHC	24.22	19880383
36	Phosphorylation	IMSSPLSTDLRQKYN EEECCCCHHHHHHCC	46.89	19880383
92	Phosphorylation	TREKVNGTTVNVGIQ EEECCCCEEEEEECC	23.51	24894044
93	Phosphorylation	REKVNGTTVNVGIQP EECCCCEEEEEECCC	16.10	24894044
101	Phosphorylation	VNVGIQPSKVVITKL EEEECCCCCEEEEEE	23.00	24894044
134	Phosphorylation	AADKEKGTKFTSEDV HCCHHHCCCCCHHHH	33.77	23776212
137	Phosphorylation	KEKGTKFTSEDVMQN HHHCCCCCHHHHHHC	32.53	23776212
138	Phosphorylation	EKGTKFTSEDVMQNV HHCCCCCHHHHHHCC	34.63	23776212
142	Sulfoxidation	KFTSEDVMQNVD--- CCCHHHHHHCCC---	3.57	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL261_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL261_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL261_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL261_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.