UniProt ID | RL22_RAT | |
---|---|---|
UniProt AC | P47198 | |
Protein Name | 60S ribosomal protein L22 | |
Gene Name | Rpl22 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 128 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAPVKKLVAKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEEPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | NLGGGVVTIERSKSK CCCCCEEEEECCCCC | 18.08 | 23984901 | |
66 | Phosphorylation | GVVTIERSKSKITVT CEEEEECCCCCEEEC | 28.61 | 25575281 | |
69 | Succinylation | TIERSKSKITVTSEE EEECCCCCEEECCCC | 46.24 | - | |
69 | Succinylation | TIERSKSKITVTSEE EEECCCCCEEECCCC | 46.24 | - | |
106 | Phosphorylation | WLRVVANSKESYELR HHHHHHCCCCEEEEE | 28.23 | 25575281 | |
109 | Phosphorylation | VVANSKESYELRYFQ HHHCCCCEEEEEEEE | 27.87 | 25575281 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL22_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL22_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL22_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL22_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...