| UniProt ID | RL22_RAT | |
|---|---|---|
| UniProt AC | P47198 | |
| Protein Name | 60S ribosomal protein L22 | |
| Gene Name | Rpl22 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 128 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAPVKKLVAKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEEPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 62 | Phosphorylation | NLGGGVVTIERSKSK CCCCCEEEEECCCCC | 18.08 | 23984901 | |
| 66 | Phosphorylation | GVVTIERSKSKITVT CEEEEECCCCCEEEC | 28.61 | 25575281 | |
| 69 | Succinylation | TIERSKSKITVTSEE EEECCCCCEEECCCC | 46.24 | - | |
| 69 | Succinylation | TIERSKSKITVTSEE EEECCCCCEEECCCC | 46.24 | - | |
| 106 | Phosphorylation | WLRVVANSKESYELR HHHHHHCCCCEEEEE | 28.23 | 25575281 | |
| 109 | Phosphorylation | VVANSKESYELRYFQ HHHCCCCEEEEEEEE | 27.87 | 25575281 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL22_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL22_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL22_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RL22_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...