UniProt ID | RL22_MOUSE | |
---|---|---|
UniProt AC | P67984 | |
Protein Name | 60S ribosomal protein L22 | |
Gene Name | Rpl22 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 128 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAPVKKLVAKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MAPVKKLVAKGG ---CCCHHHHHCCCC | 39.05 | 166003 | |
6 | Acetylation | --MAPVKKLVAKGGK --CCCHHHHHCCCCC | 48.72 | 166007 | |
10 | Acetylation | PVKKLVAKGGKKKKQ CHHHHHCCCCCCCCE | 61.80 | 166011 | |
22 | Phosphorylation | KKQVLKFTLDCTHPV CCEEEEEEECCCCCC | 21.79 | 26239621 | |
25 | S-palmitoylation | VLKFTLDCTHPVEDG EEEEEECCCCCCCCC | 4.18 | 28526873 | |
25 | S-nitrosylation | VLKFTLDCTHPVEDG EEEEEECCCCCCCCC | 4.18 | 21278135 | |
25 | Glutathionylation | VLKFTLDCTHPVEDG EEEEEECCCCCCCCC | 4.18 | 24333276 | |
25 | S-nitrosocysteine | VLKFTLDCTHPVEDG EEEEEECCCCCCCCC | 4.18 | - | |
26 | Phosphorylation | LKFTLDCTHPVEDGI EEEEECCCCCCCCCC | 28.96 | 26239621 | |
52 | Ubiquitination | ERIKVNGKAGNLGGG HHHHHCCCCCCCCCC | 48.17 | 22790023 | |
62 | Phosphorylation | NLGGGVVTIERSKSK CCCCCEEEEECCCCE | 18.08 | 22817900 | |
66 | Phosphorylation | GVVTIERSKSKITVT CEEEEECCCCEEEEE | 28.61 | 22324799 | |
68 | Phosphorylation | VTIERSKSKITVTSE EEEECCCCEEEEEEE | 30.45 | 29514104 | |
69 | Acetylation | TIERSKSKITVTSEV EEECCCCEEEEEEEC | 46.24 | 23806337 | |
69 | Succinylation | TIERSKSKITVTSEV EEECCCCEEEEEEEC | 46.24 | 23806337 | |
69 | Malonylation | TIERSKSKITVTSEV EEECCCCEEEEEEEC | 46.24 | 26320211 | |
69 | Succinylation | TIERSKSKITVTSEV EEECCCCEEEEEEEC | 46.24 | - | |
74 | Phosphorylation | KSKITVTSEVPFSKR CCEEEEEEECCCCHH | 32.06 | 29514104 | |
80 | Succinylation | TSEVPFSKRYLKYLT EEECCCCHHHHHHHH | 45.50 | 23806337 | |
80 | Acetylation | TSEVPFSKRYLKYLT EEECCCCHHHHHHHH | 45.50 | 23806337 | |
84 | Acetylation | PFSKRYLKYLTKKYL CCCHHHHHHHHHHHH | 29.31 | 22826441 | |
106 | Phosphorylation | WLRVVANSKESYELR HHHHHHCCCCEEEEE | 28.23 | 29514104 | |
107 | Ubiquitination | LRVVANSKESYELRY HHHHHCCCCEEEEEE | 50.95 | - | |
107 | Acetylation | LRVVANSKESYELRY HHHHHCCCCEEEEEE | 50.95 | 22826441 | |
107 | Malonylation | LRVVANSKESYELRY HHHHHCCCCEEEEEE | 50.95 | 26320211 | |
109 | Phosphorylation | VVANSKESYELRYFQ HHHCCCCEEEEEEEE | 27.87 | 23737553 | |
110 | Phosphorylation | VANSKESYELRYFQI HHCCCCEEEEEEEEE | 21.78 | 23737553 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL22_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL22_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL22_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL22_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...