RL21A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL21A_SCHPO
• UniProt AC: Q9UUC1
• Protein Name: 60S ribosomal protein L21-A
• Gene Name: rpl2101
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 160
• Protein Sequence: MPHSYGIRARTRYTFQRGFREHGQIRLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVYNVTQSSVGVLIYKVVGNRYMEKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRRQPAPPAKAHFVSTENNEPVTLHPVAYDTTI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MPHSYGIRART ----CCCCCCCHHHC	21.13	29996109
33	Phosphorylation	RLSTYLKTYKVGDIV EEEEEEEEEEECCEE	26.44	25720772
158	Phosphorylation	LHPVAYDTTI----- EEEEEEECCC-----	17.45	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL21A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL21A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL21A_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL21A_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.