RL18_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL18_RAT
• UniProt AC: P12001
• Protein Name: 60S ribosomal protein L18
• Gene Name: Rpl18
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 188
• Subcellular Localization: Cytoplasm, cytosol . Cytoplasm . Rough endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity).
• Protein Description: Component of the large ribosomal subunit..
• Protein Sequence: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Phosphorylation	YRFLARRTNSTFNQV HHHHHHHCCCCHHHH	28.15	23984901
41	Phosphorylation	FLARRTNSTFNQVVL HHHHHCCCCHHHHHH	33.49	23984901
42	Phosphorylation	LARRTNSTFNQVVLK HHHHCCCCHHHHHHH	28.77	23984901
64	Phosphorylation	NRPPLSLSRMIRKMK CCCCCCHHHHHHHCC	19.20	23984901
78	Ubiquitination	KLPGRENKTAVVVGT CCCCCCCCEEEEEEE	32.86	-
85	Phosphorylation	KTAVVVGTITDDVRI CEEEEEEEECCCEEE	14.75	23984901
87	Phosphorylation	AVVVGTITDDVRILE EEEEEEECCCEEEEE	26.45	23984901
106	Phosphorylation	KVCALRVSSRARSRI EEEEEECCHHHHHHH	13.99	23984901
107	Phosphorylation	VCALRVSSRARSRIL EEEEECCHHHHHHHH	27.40	23984901
122	Phosphorylation	KAGGKILTFDQLALE HHCCEEEEEEEEECC	28.74	25575281
130	Phosphorylation	FDQLALESPKGRGTV EEEEECCCCCCCCEE	32.53	27097102
132	Ubiquitination	QLALESPKGRGTVLL EEECCCCCCCCEEEE	71.20	-
140	Phosphorylation	GRGTVLLSGPRKGRE CCCEEEECCCCCCHH	42.46	23984901
154	Acetylation	EVYRHFGKAPGTPHS HHHHHCCCCCCCCCC	50.92	22902405
158	Phosphorylation	HFGKAPGTPHSHTKP HCCCCCCCCCCCCCH	19.44	25575281
161	Phosphorylation	KAPGTPHSHTKPYVR CCCCCCCCCCCHHCC	33.77	25575281
163	Phosphorylation	PGTPHSHTKPYVRSK CCCCCCCCCHHCCCC	36.41	25575281
164	Acetylation	GTPHSHTKPYVRSKG CCCCCCCCHHCCCCC	29.00	22902405

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL18_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL18_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL18_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of RL18_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.