UniProt ID | RL18_MOUSE | |
---|---|---|
UniProt AC | P35980 | |
Protein Name | 60S ribosomal protein L18 | |
Gene Name | Rpl18 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 188 | |
Subcellular Localization | Cytoplasm, cytosol . Cytoplasm . Rough endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity). | |
Protein Description | Component of the large ribosomal subunit.. | |
Protein Sequence | MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | VRRKEPKSQDIYLRL CCCCCCCCHHHHHHH | 43.74 | 28066266 | |
30 | Ubiquitination | IYLRLLVKLYRFLAR HHHHHHHHHHHHHHH | 39.51 | - | |
30 | Acetylation | IYLRLLVKLYRFLAR HHHHHHHHHHHHHHH | 39.51 | 23201123 | |
49 | Ubiquitination | TFNQVVLKRLFMSRT CHHHHHHHHHHHCCC | 35.13 | - | |
49 | Succinylation | TFNQVVLKRLFMSRT CHHHHHHHHHHHCCC | 35.13 | 23806337 | |
49 | Acetylation | TFNQVVLKRLFMSRT CHHHHHHHHHHHCCC | 35.13 | 23806337 | |
56 | Phosphorylation | KRLFMSRTNRPPLSL HHHHHCCCCCCCCCH | 28.42 | 24899341 | |
62 | Phosphorylation | RTNRPPLSLSRMIRK CCCCCCCCHHHHHHH | 30.03 | 29176673 | |
64 | Phosphorylation | NRPPLSLSRMIRKMK CCCCCCHHHHHHHCC | 19.20 | 29176673 | |
78 | Ubiquitination | KLPGRENKTAVVVGT CCCCCCCCEEEEEEE | 32.86 | 22790023 | |
97 | Acetylation | VRILEVPKLKVCALR EEEEECCCCEEEEEE | 67.14 | 23201123 | |
101 | S-palmitoylation | EVPKLKVCALRVSSR ECCCCEEEEEECCHH | 2.56 | 28526873 | |
101 | Glutathionylation | EVPKLKVCALRVSSR ECCCCEEEEEECCHH | 2.56 | 24333276 | |
106 | Phosphorylation | KVCALRVSSRARSRI EEEEEECCHHHHHHH | 13.99 | 27600695 | |
107 | Phosphorylation | VCALRVSSRARSRIL EEEEECCHHHHHHHH | 27.40 | - | |
119 | Ubiquitination | RILKAGGKILTFDQL HHHHHCCEEEEEEEE | 33.36 | 22790023 | |
119 | Acetylation | RILKAGGKILTFDQL HHHHHCCEEEEEEEE | 33.36 | 23236377 | |
122 | Phosphorylation | KAGGKILTFDQLALE HHCCEEEEEEEEECC | 28.74 | 25777480 | |
130 | Phosphorylation | FDQLALESPKGRGTV EEEEECCCCCCCCEE | 32.53 | 27087446 | |
132 | Ubiquitination | QLALESPKGRGTVLL EEECCCCCCCCEEEE | 71.20 | - | |
132 | Acetylation | QLALESPKGRGTVLL EEECCCCCCCCEEEE | 71.20 | 23806337 | |
132 | Succinylation | QLALESPKGRGTVLL EEECCCCCCCCEEEE | 71.20 | 23806337 | |
136 | Phosphorylation | ESPKGRGTVLLSGPR CCCCCCCEEEECCCC | 13.45 | 22817900 | |
140 | Phosphorylation | GRGTVLLSGPRKGRE CCCEEEECCCCCCHH | 42.46 | 22817900 | |
149 | Phosphorylation | PRKGREVYRHFGKAP CCCCHHHHHHCCCCC | 8.13 | 29514104 | |
158 | Phosphorylation | HFGKAPGTPHSHTKP HCCCCCCCCCCCCCH | 19.44 | 26824392 | |
161 | Phosphorylation | KAPGTPHSHTKPYVR CCCCCCCCCCCHHCC | 33.77 | 25159016 | |
163 | Phosphorylation | PGTPHSHTKPYVRSK CCCCCCCCCHHCCCC | 36.41 | 28066266 | |
166 | Phosphorylation | PHSHTKPYVRSKGRK CCCCCCHHCCCCCHH | 15.28 | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL18_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL18_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL18_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL18_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...