RL14_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL14_SCHPO
• UniProt AC: O94238
• Protein Name: 60S ribosomal protein L14
• Gene Name: rpl14
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 134
• Protein Sequence: MEGFKRYVEVGRVVLVTKGEYTGKLAVIVDIVDHKRALIDSPCSEFPRQVIRYGSVVLTHIVMKLPRGARSGIVAKKWKAQDVCNKWASSAWAKKLEAKKVRSQLNDFDRFAVMRLKKQRREQVNVAVAKALKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	FPRQVIRYGSVVLTH CCHHHHHHHHHHHHH	11.57	25720772
55	Phosphorylation	RQVIRYGSVVLTHIV HHHHHHHHHHHHHHH	10.50	25720772
89	Phosphorylation	DVCNKWASSAWAKKL HHHHHHHHHHHHHHH	21.34	27738172
103	Phosphorylation	LEAKKVRSQLNDFDR HHHHHHHHHCCCHHH	41.84	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL14_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL14_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL14_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL14_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.