UniProt ID | RL14_MOUSE | |
---|---|---|
UniProt AC | Q9CR57 | |
Protein Name | 60S ribosomal protein L14 | |
Gene Name | Rpl14 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 217 | |
Subcellular Localization | ||
Protein Description | Component of the large ribosomal subunit.. | |
Protein Sequence | MVFRRYVEVGRVAYISFGPHAGKLVAIVDVIDQNRALVDGPCTRVRRQAMPFKCMQLTDFILKFPHSARQKYVRKAWEKADINTKWAATRWAKKIDARERKAKMTDFDRFKVMKAKKMRNRIIKTEVKKLQRAAILKASPKKAAVAKAAIAAAAAAAAAKAKVPAKKATGPGKKAAGQKAPAQKAAGQKAAPPAKGQKGQKTPAQKAPAPKAAGKKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MVFRRYVEVGRVA --CCCCEEEEECCEE | 9.19 | 29514104 | |
14 | Phosphorylation | VEVGRVAYISFGPHA EEECCEEEEEECCCC | 8.34 | 29514104 | |
42 | S-nitrosocysteine | RALVDGPCTRVRRQA CCCCCCCCHHHHHHH | 4.67 | - | |
42 | S-palmitoylation | RALVDGPCTRVRRQA CCCCCCCCHHHHHHH | 4.67 | 28526873 | |
42 | S-nitrosylation | RALVDGPCTRVRRQA CCCCCCCCHHHHHHH | 4.67 | 20925432 | |
42 | Glutathionylation | RALVDGPCTRVRRQA CCCCCCCCHHHHHHH | 4.67 | 24333276 | |
53 | Acetylation | RRQAMPFKCMQLTDF HHHHCCCHHHHHHHH | 23.95 | 22826441 | |
54 | S-nitrosocysteine | RQAMPFKCMQLTDFI HHHCCCHHHHHHHHH | 1.83 | - | |
54 | S-palmitoylation | RQAMPFKCMQLTDFI HHHCCCHHHHHHHHH | 1.83 | 28526873 | |
54 | S-nitrosylation | RQAMPFKCMQLTDFI HHHCCCHHHHHHHHH | 1.83 | 20925432 | |
54 | Glutathionylation | RQAMPFKCMQLTDFI HHHCCCHHHHHHHHH | 1.83 | 24333276 | |
63 | Ubiquitination | QLTDFILKFPHSARQ HHHHHHHHCCHHHHH | 52.62 | - | |
79 | Acetylation | YVRKAWEKADINTKW HHHHHHHHCCCCHHH | 40.43 | 23864654 | |
79 | Ubiquitination | YVRKAWEKADINTKW HHHHHHHHCCCCHHH | 40.43 | 27667366 | |
79 | Malonylation | YVRKAWEKADINTKW HHHHHHHHCCCCHHH | 40.43 | 26320211 | |
79 | Succinylation | YVRKAWEKADINTKW HHHHHHHHCCCCHHH | 40.43 | 23806337 | |
85 | Succinylation | EKADINTKWAATRWA HHCCCCHHHHHHHHH | 30.28 | 23806337 | |
85 | Acetylation | EKADINTKWAATRWA HHCCCCHHHHHHHHH | 30.28 | 23806337 | |
85 | Succinylation | EKADINTKWAATRWA HHCCCCHHHHHHHHH | 30.28 | - | |
85 | Ubiquitination | EKADINTKWAATRWA HHCCCCHHHHHHHHH | 30.28 | - | |
103 | Ubiquitination | DARERKAKMTDFDRF CHHHHHHCCCCHHHH | 45.42 | 27667366 | |
124 | Ubiquitination | KMRNRIIKTEVKKLQ HHHHHHHHHHHHHHH | 35.94 | 27667366 | |
137 | Ubiquitination | LQRAAILKASPKKAA HHHHHHHHCCHHHHH | 40.48 | 27667366 | |
137 | Malonylation | LQRAAILKASPKKAA HHHHHHHHCCHHHHH | 40.48 | 26320211 | |
139 | Phosphorylation | RAAILKASPKKAAVA HHHHHHCCHHHHHHH | 35.35 | 18388127 | |
147 | Ubiquitination | PKKAAVAKAAIAAAA HHHHHHHHHHHHHHH | 31.58 | 27667366 | |
160 | Acetylation | AAAAAAAKAKVPAKK HHHHHHHHCCCCHHH | 43.97 | 23806337 | |
160 | Succinylation | AAAAAAAKAKVPAKK HHHHHHHHCCCCHHH | 43.97 | 23806337 | |
160 | Ubiquitination | AAAAAAAKAKVPAKK HHHHHHHHCCCCHHH | 43.97 | 27667366 | |
160 | Malonylation | AAAAAAAKAKVPAKK HHHHHHHHCCCCHHH | 43.97 | 26320211 | |
179 | Malonylation | GKKAAGQKAPAQKAA CHHHCCCCCHHHHHC | 56.26 | 32601280 | |
184 | Malonylation | GQKAPAQKAAGQKAA CCCCHHHHHCCCCCC | 42.16 | 26320211 | |
189 | Malonylation | AQKAAGQKAAPPAKG HHHHCCCCCCCCCCC | 45.67 | 26320211 | |
189 | Succinylation | AQKAAGQKAAPPAKG HHHHCCCCCCCCCCC | 45.67 | 23806337 | |
189 | Ubiquitination | AQKAAGQKAAPPAKG HHHHCCCCCCCCCCC | 45.67 | 27667366 | |
189 | Acetylation | AQKAAGQKAAPPAKG HHHHCCCCCCCCCCC | 45.67 | 23806337 | |
195 | Malonylation | QKAAPPAKGQKGQKT CCCCCCCCCCCCCCC | 68.59 | 32601280 | |
202 | Phosphorylation | KGQKGQKTPAQKAPA CCCCCCCCCCCCCCC | 18.90 | 25266776 | |
206 | Succinylation | GQKTPAQKAPAPKAA CCCCCCCCCCCCHHC | 59.45 | 23806337 | |
206 | Malonylation | GQKTPAQKAPAPKAA CCCCCCCCCCCCHHC | 59.45 | 26320211 | |
206 | Ubiquitination | GQKTPAQKAPAPKAA CCCCCCCCCCCCHHC | 59.45 | 27667366 | |
206 | Acetylation | GQKTPAQKAPAPKAA CCCCCCCCCCCCHHC | 59.45 | 23806337 | |
206 | Succinylation | GQKTPAQKAPAPKAA CCCCCCCCCCCCHHC | 59.45 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL14_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL14_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL14_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL14_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...