UniProt ID | RL13_MOUSE | |
---|---|---|
UniProt AC | P47963 | |
Protein Name | 60S ribosomal protein L13 | |
Gene Name | Rpl13 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 211 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAPSRNGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Acetylation | ILKPHFHKDWQQRVD EECCCCCHHHHHHHH | 60.77 | - | |
52 | Phosphorylation | RIAPRPASGPIRPIV HHCCCCCCCCCCCCE | 48.02 | 26824392 | |
61 | Glutathionylation | PIRPIVRCPTVRYHT CCCCCEECCCCEEEC | 1.99 | 24333276 | |
77 | Phosphorylation | VRAGRGFSLEELRVA CCCCCCCCHHHHHHC | 37.38 | 26824392 | |
97 | Phosphorylation | VARTIGISVDPRRRN HHHHHCCCCCCCCCC | 18.43 | 29514104 | |
105 | Acetylation | VDPRRRNKSTESLQA CCCCCCCCCHHHHHH | 57.87 | 23806337 | |
105 | Ubiquitination | VDPRRRNKSTESLQA CCCCCCCCCHHHHHH | 57.87 | - | |
105 | Succinylation | VDPRRRNKSTESLQA CCCCCCCCCHHHHHH | 57.87 | 23806337 | |
106 | Phosphorylation | DPRRRNKSTESLQAN CCCCCCCCHHHHHHH | 40.74 | 25521595 | |
107 | Phosphorylation | PRRRNKSTESLQANV CCCCCCCHHHHHHHH | 31.07 | 22942356 | |
109 | Phosphorylation | RRNKSTESLQANVQR CCCCCHHHHHHHHHH | 26.35 | 25168779 | |
122 | Phosphorylation | QRLKEYRSKLILFPR HHHHHHHHHEEEECC | 30.80 | 21183079 | |
123 | Ubiquitination | RLKEYRSKLILFPRK HHHHHHHHEEEECCC | 30.46 | 22790023 | |
123 | Acetylation | RLKEYRSKLILFPRK HHHHHHHHEEEECCC | 30.46 | 23806337 | |
136 | Ubiquitination | RKPSAPKKGDSSAEE CCCCCCCCCCCCHHH | 67.88 | - | |
139 | Phosphorylation | SAPKKGDSSAEELKL CCCCCCCCCHHHHHH | 39.87 | 26824392 | |
140 | Phosphorylation | APKKGDSSAEELKLA CCCCCCCCHHHHHHH | 44.43 | 25521595 | |
145 | Acetylation | DSSAEELKLATQLTG CCCHHHHHHHHHHHC | 39.08 | 23864654 | |
145 | Ubiquitination | DSSAEELKLATQLTG CCCHHHHHHHHHHHC | 39.08 | 22790023 | |
148 | Phosphorylation | AEELKLATQLTGPVM HHHHHHHHHHHCCCC | 34.25 | 25293948 | |
151 | Phosphorylation | LKLATQLTGPVMPIR HHHHHHHHCCCCCCC | 29.62 | 29514104 | |
161 | Phosphorylation | VMPIRNVYKKEKARV CCCCCCCCHHHHCEE | 21.64 | 29514104 | |
174 | Succinylation | RVITEEEKNFKAFAS EEECHHHHHHHHHHH | 71.60 | 23954790 | |
174 | Acetylation | RVITEEEKNFKAFAS EEECHHHHHHHHHHH | 71.60 | 22826441 | |
177 | Acetylation | TEEEKNFKAFASLRM CHHHHHHHHHHHHHH | 52.57 | 23864654 | |
181 | Phosphorylation | KNFKAFASLRMARAN HHHHHHHHHHHHHHH | 15.28 | 27149854 | |
209 | Malonylation | AAEQDVEKKK----- HHHHHHHHCC----- | 66.75 | 26073543 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL13_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL13_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL13_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL13_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...