UniProt ID | RL13A_MOUSE | |
---|---|---|
UniProt AC | P19253 | |
Protein Name | 60S ribosomal protein L13a | |
Gene Name | Rpl13a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 203 | |
Subcellular Localization | ||
Protein Description | Associated with ribosomes but is not required for canonical ribosome function and has extra-ribosomal functions (By similarity). Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma activation and subsequent phosphorylation dissociates from the ribosome and assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation. In the GAIT complex interacts with m7G cap-bound eIF4G at or near the eIF3-binding site and blocks the recruitment of the 43S ribosomal complex.. | |
Protein Sequence | MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEGQVLVL ------CCCCCEEEE | 29.62 | - | |
25 | Ubiquitination | RLAAIVAKQVLLGRK HHHHHHHHHHHCCCC | 30.00 | - | |
25 | Acetylation | RLAAIVAKQVLLGRK HHHHHHHHHHHCCCC | 30.00 | 22826441 | |
38 | S-palmitoylation | RKVVVVRCEGINISG CCEEEEECEEECCCC | 3.67 | 28526873 | |
38 | S-nitrosylation | RKVVVVRCEGINISG CCEEEEECEEECCCC | 3.67 | 21278135 | |
38 | S-nitrosocysteine | RKVVVVRCEGINISG CCEEEEECEEECCCC | 3.67 | - | |
53 | Acetylation | NFYRNKLKYLAFLRK CCHHHHHHHHHHHHH | 39.57 | 22826441 | |
53 | Ubiquitination | NFYRNKLKYLAFLRK CCHHHHHHHHHHHHH | 39.57 | - | |
54 | Phosphorylation | FYRNKLKYLAFLRKR CHHHHHHHHHHHHHH | 17.44 | 29514104 | |
59 | Citrullination | LKYLAFLRKRMNTNP HHHHHHHHHHCCCCC | 20.34 | - | |
59 | Citrullination | LKYLAFLRKRMNTNP HHHHHHHHHHCCCCC | 20.34 | 24463520 | |
71 | Phosphorylation | TNPSRGPYHFRAPSR CCCCCCCCCCCCCCH | 19.20 | 29514104 | |
77 | Phosphorylation | PYHFRAPSRIFWRTV CCCCCCCCHHHHHHH | 36.70 | 23071094 | |
103 | Ubiquitination | QAALERLKVLDGIPP HHHHHHHHHHCCCCC | 47.15 | - | |
114 | Ubiquitination | GIPPPYDKKKRMVVP CCCCCCCHHHCCHHH | 55.11 | - | |
115 | Ubiquitination | IPPPYDKKKRMVVPA CCCCCCHHHCCHHHH | 42.59 | - | |
125 | Acetylation | MVVPAALKVVRLKPT CHHHHHHEEEECCCC | 33.68 | 22826441 | |
125 | Ubiquitination | MVVPAALKVVRLKPT CHHHHHHEEEECCCC | 33.68 | - | |
134 | Acetylation | VRLKPTRKFAYLGRL EECCCCCCHHHHHHH | 36.50 | 22826441 | |
134 | Ubiquitination | VRLKPTRKFAYLGRL EECCCCCCHHHHHHH | 36.50 | - | |
140 | Citrullination | RKFAYLGRLAHEVGW CCHHHHHHHHHHHHH | 26.55 | 24463520 | |
140 | Citrullination | RKFAYLGRLAHEVGW CCHHHHHHHHHHHHH | 26.55 | - | |
148 | Acetylation | LAHEVGWKYQAVTAT HHHHHHHHHHHHHHC | 22.89 | 22826441 | |
149 | Phosphorylation | AHEVGWKYQAVTATL HHHHHHHHHHHHHCH | 8.66 | 29514104 | |
155 | Phosphorylation | KYQAVTATLEEKRKE HHHHHHHCHHHHHHH | 25.90 | 25338131 | |
159 | Ubiquitination | VTATLEEKRKEKAKM HHHCHHHHHHHHHHH | 60.44 | - | |
183 | Acetylation | RLRKQAEKNVEKKIC HHHHHHHHHHHHHHH | 70.12 | 23201123 | |
188 | Acetylation | AEKNVEKKICKFTEV HHHHHHHHHHHHHHH | 39.57 | 23201123 | |
188 | Ubiquitination | AEKNVEKKICKFTEV HHHHHHHHHHHHHHH | 39.57 | - | |
190 | Glutathionylation | KNVEKKICKFTEVLK HHHHHHHHHHHHHHH | 3.99 | 24333276 | |
191 | Ubiquitination | NVEKKICKFTEVLKT HHHHHHHHHHHHHHH | 59.81 | - | |
191 | Acetylation | NVEKKICKFTEVLKT HHHHHHHHHHHHHHH | 59.81 | 23806337 | |
191 | Malonylation | NVEKKICKFTEVLKT HHHHHHHHHHHHHHH | 59.81 | 26320211 | |
191 | Succinylation | NVEKKICKFTEVLKT HHHHHHHHHHHHHHH | 59.81 | 23806337 | |
197 | Ubiquitination | CKFTEVLKTNGLLV- HHHHHHHHHCCCCC- | 45.15 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
77 | S | Phosphorylation | Kinase | DAPK3 | O54784 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
77 | S | Phosphorylation |
| 23071094 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL13A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL13A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...