RL133_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL133_ARATH
• UniProt AC: Q9FF90
• Protein Name: 60S ribosomal protein L13-3
• Gene Name: RPL13D
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 206
• Protein Sequence: MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGKGFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAMELVKLTADLKAFKAYDKIRLERTNARHAGARAKRAAEAEKEEKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	VKIFPRPTSGPLRPV EEECCCCCCCCCCCE	47.82	25561503
50	Phosphorylation	KIFPRPTSGPLRPVV EECCCCCCCCCCCEE	40.89	25561503
104	Phosphorylation	DHRRKNRSLEGLQSN CCHHHCCCHHHHHHH	39.92	30407730
137	Phosphorylation	RQVKAGDSTPEELAN CCCCCCCCCHHHHHH	44.97	23776212
138	Phosphorylation	QVKAGDSTPEELANA CCCCCCCCHHHHHHH	39.19	23776212
146	Phosphorylation	PEELANATQVQGDYM HHHHHHHHHCCCCCC	29.13	23776212
152	Phosphorylation	ATQVQGDYMPIASVK HHHCCCCCCCHHHHH	16.18	19376835
157	Phosphorylation	GDYMPIASVKAAMEL CCCCCHHHHHHHHHH	25.52	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL133_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL133_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL133_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL133_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.