UniProt ID | RL133_ARATH | |
---|---|---|
UniProt AC | Q9FF90 | |
Protein Name | 60S ribosomal protein L13-3 | |
Gene Name | RPL13D | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 206 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGKGFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAMELVKLTADLKAFKAYDKIRLERTNARHAGARAKRAAEAEKEEKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | VKIFPRPTSGPLRPV EEECCCCCCCCCCCE | 47.82 | 25561503 | |
50 | Phosphorylation | KIFPRPTSGPLRPVV EECCCCCCCCCCCEE | 40.89 | 25561503 | |
104 | Phosphorylation | DHRRKNRSLEGLQSN CCHHHCCCHHHHHHH | 39.92 | 30407730 | |
137 | Phosphorylation | RQVKAGDSTPEELAN CCCCCCCCCHHHHHH | 44.97 | 23776212 | |
138 | Phosphorylation | QVKAGDSTPEELANA CCCCCCCCHHHHHHH | 39.19 | 23776212 | |
146 | Phosphorylation | PEELANATQVQGDYM HHHHHHHHHCCCCCC | 29.13 | 23776212 | |
152 | Phosphorylation | ATQVQGDYMPIASVK HHHCCCCCCCHHHHH | 16.18 | 19376835 | |
157 | Phosphorylation | GDYMPIASVKAAMEL CCCCCHHHHHHHHHH | 25.52 | 19376835 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL133_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL133_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL133_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL133_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...