UniProt ID | RL12_MOUSE | |
---|---|---|
UniProt AC | P35979 | |
Protein Name | 60S ribosomal protein L12 | |
Gene Name | Rpl12 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 165 | |
Subcellular Localization | ||
Protein Description | Binds directly to 26S ribosomal RNA.. | |
Protein Sequence | MPPKFDPNEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Glutathionylation | VKVVYLRCTGGEVGA CEEEEEEECCCCCCC | 3.70 | 24333276 | |
17 | S-nitrosocysteine | VKVVYLRCTGGEVGA CEEEEEEECCCCCCC | 3.70 | - | |
17 | S-nitrosylation | VKVVYLRCTGGEVGA CEEEEEEECCCCCCC | 3.70 | 21278135 | |
17 | S-palmitoylation | VKVVYLRCTGGEVGA CEEEEEEECCCCCCC | 3.70 | 28526873 | |
18 | Phosphorylation | KVVYLRCTGGEVGAT EEEEEEECCCCCCCC | 41.61 | 20139300 | |
38 | Phosphorylation | KIGPLGLSPKKVGDD CCCCCCCCHHHHCHH | 32.64 | 26824392 | |
40 | Acetylation | GPLGLSPKKVGDDIA CCCCCCHHHHCHHHH | 57.63 | 90307 | |
40 | Malonylation | GPLGLSPKKVGDDIA CCCCCCHHHHCHHHH | 57.63 | 26320211 | |
41 | Malonylation | PLGLSPKKVGDDIAK CCCCCHHHHCHHHHH | 55.63 | 26320211 | |
48 | Ubiquitination | KVGDDIAKATGDWKG HHCHHHHHHHCCCCC | 46.98 | - | |
48 | Malonylation | KVGDDIAKATGDWKG HHCHHHHHHHCCCCC | 46.98 | 26320211 | |
48 | Acetylation | KVGDDIAKATGDWKG HHCHHHHHHHCCCCC | 46.98 | 23236377 | |
54 | Acetylation | AKATGDWKGLRITVK HHHHCCCCCEEEEEE | 53.45 | 23864654 | |
54 | Malonylation | AKATGDWKGLRITVK HHHHCCCCCEEEEEE | 53.45 | 26320211 | |
61 | Ubiquitination | KGLRITVKLTIQNRQ CCEEEEEEEEEECCC | 31.12 | 22790023 | |
76 | Phosphorylation | AQIEVVPSASALIIK HHEEEECCHHHHHHH | 24.20 | 22006019 | |
83 | Ubiquitination | SASALIIKALKEPPR CHHHHHHHHHCCCCC | 40.44 | 22790023 | |
83 | Acetylation | SASALIIKALKEPPR CHHHHHHHHHCCCCC | 40.44 | 22826441 | |
86 | Malonylation | ALIIKALKEPPRDRK HHHHHHHCCCCCCHH | 73.38 | 26320211 | |
99 | Ubiquitination | RKKQKNIKHSGNITF HHHHHCCCCCCCCCH | 40.90 | 22790023 | |
120 | Phosphorylation | ARQMRHRSLARELSG HHHHHHHHHHHHHHH | 21.91 | 29550500 | |
126 | Phosphorylation | RSLARELSGTIKEIL HHHHHHHHHHHHHHH | 29.18 | 22942356 | |
128 | Phosphorylation | LARELSGTIKEILGT HHHHHHHHHHHHHCH | 26.04 | 26745281 | |
130 | Ubiquitination | RELSGTIKEILGTAQ HHHHHHHHHHHCHHH | 38.24 | 22790023 | |
135 | Phosphorylation | TIKEILGTAQSVGCN HHHHHHCHHHHCCCC | 20.34 | 26160508 | |
141 | Glutathionylation | GTAQSVGCNVDGRHP CHHHHCCCCCCCCCH | 4.15 | 24333276 | |
141 | S-nitrosylation | GTAQSVGCNVDGRHP CHHHHCCCCCCCCCH | 4.15 | 21278135 | |
141 | S-nitrosocysteine | GTAQSVGCNVDGRHP CHHHHCCCCCCCCCH | 4.15 | - | |
141 | S-palmitoylation | GTAQSVGCNVDGRHP CHHHHCCCCCCCCCH | 4.15 | 28526873 | |
157 | Phosphorylation | DIIDDINSGAVECPA HCCCCCCCCCCCCCC | 28.59 | 30635358 | |
162 | S-nitrosocysteine | INSGAVECPAS---- CCCCCCCCCCC---- | 2.47 | - | |
162 | S-nitrosylation | INSGAVECPAS---- CCCCCCCCCCC---- | 2.47 | 21278135 | |
162 | S-palmitoylation | INSGAVECPAS---- CCCCCCCCCCC---- | 2.47 | 28526873 | |
165 | Phosphorylation | GAVECPAS------- CCCCCCCC------- | 26.37 | 25521595 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL12_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL12_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL12_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL12_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...