RL121_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL121_ARATH
• UniProt AC: P50883
• Protein Name: 60S ribosomal protein L12-1
• Gene Name: RPL12A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 166
• Protein Description: Binds directly to 26S ribosomal RNA..
• Protein Sequence: MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPRSIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGEVEIPEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Methylation	----MPPKLDPSQIV ----CCCCCCHHHEE	60.70	17934214
4	Acetylation	----MPPKLDPSQIV ----CCCCCCHHHEE	60.70	21311030
18	Phosphorylation	VDVYVRVTGGEVGAA EEEEEEECCCCCHHH	28.98	22092075
41	Acetylation	PLGLAPKKIGEDIAK CCCCCCHHHCHHHHH	55.68	21311030
73	Phosphorylation	QNRQAKVTVVPSAAA ECCCCEEEEECCHHH	18.32	22092075
106	Phosphorylation	IKHNGNISFDDVTEI CCCCCCCCHHHHHHH	26.99	22092075

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL121_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL121_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL121_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL121_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.