UniProt ID | RL103_ARATH | |
---|---|---|
UniProt AC | Q93W22 | |
Protein Name | 60S ribosomal protein L10-3 | |
Gene Name | RPL10C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 221 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDNHGVHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRAEYTKLRAMKRIVPDGVNAKFLSNHGPLANRQPGSAFISATSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
182 | Phosphorylation | KFNRAEYTKLRAMKR CCCHHHHHHHHHHHH | 18.33 | 24894044 | |
213 | Phosphorylation | LANRQPGSAFISATS CCCCCCCCCEEEECC | 27.04 | 30291188 | |
217 | Phosphorylation | QPGSAFISATSE--- CCCCCEEEECCC--- | 21.02 | 23172892 | |
219 | Phosphorylation | GSAFISATSE----- CCCEEEECCC----- | 26.97 | 23776212 | |
220 | Phosphorylation | SAFISATSE------ CCEEEECCC------ | 40.81 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL103_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL103_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL103_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL103_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...