RL103_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL103_ARATH
• UniProt AC: Q93W22
• Protein Name: 60S ribosomal protein L10-3
• Gene Name: RPL10C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 221
• Protein Sequence: MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDNHGVHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRAEYTKLRAMKRIVPDGVNAKFLSNHGPLANRQPGSAFISATSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
182	Phosphorylation	KFNRAEYTKLRAMKR CCCHHHHHHHHHHHH	18.33	24894044
213	Phosphorylation	LANRQPGSAFISATS CCCCCCCCCEEEECC	27.04	30291188
217	Phosphorylation	QPGSAFISATSE--- CCCCCEEEECCC---	21.02	23172892
219	Phosphorylation	GSAFISATSE----- CCCEEEECCC-----	26.97	23776212
220	Phosphorylation	SAFISATSE------ CCEEEECCC------	40.81	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL103_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL103_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL103_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RL103_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.