RK9_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RK9_ARATH
• UniProt AC: P25864
• Protein Name: 50S ribosomal protein L9, chloroplastic
• Gene Name: RPL9
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 197
• Subcellular Localization: Plastid, chloroplast.
• Protein Description: Binds to the 23S rRNA..
• Protein Sequence: MASSTALSLSWSSSPCWSHSFNGGANETLKVSERRFNFEVVSQKKAKKLRKVILKEDVTDLGKQGQLLDVKAGFFRNFLLPTGKAQLMTPLLLKELKMEDERIEAEKQRVKEEAQQLAMVFQTVGAFKVKRKGGKGKLIFGSVTAQDLVDIIKSQLQKDIDKRLVSLPEIRETGEYIAELKLHPDVTARVKINVFAN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
88	Sulfoxidation	PTGKAQLMTPLLLKE CCCCHHHHHHHHHHH	2.11	25693801
98	Sulfoxidation	LLLKELKMEDERIEA HHHHHHCCHHHHHHH	14.18	25693801
142	Phosphorylation	KGKLIFGSVTAQDLV CCEEEEEEEEHHHHH	12.92	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RK9_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RK9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RK9_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RK9_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.