UniProt ID | RK5_ARATH | |
---|---|---|
UniProt AC | O04603 | |
Protein Name | 50S ribosomal protein L5, chloroplastic | |
Gene Name | RPL5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 262 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | Binds 5S rRNA, forms part of the central protuberance of the 50S subunit.. | |
Protein Sequence | MASPSLLQSSASSFHGRFSPLAAPSSARMLSPPLRNVVKVSASGTVLVEKSEAEKTQRLKTAYLERIIPALKEEFKYVNIHQVPKVQKIVVNCGIGDAAQNDKGLEAAMKDIALITGQKPIKTRARASIATFKIREDQPLGIAVTLRGDVMYSFLDRLINLALPRTRDFQGVSPSSFDGNGNYSIGVKDQGVFPEIRFDAVGKTRGMDVCISTTAKSDQEGQKLLALMGMPFREGGGGSTGAIVRKKKLKSHHFDAKGKGKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | SSFHGRFSPLAAPSS HHCCCCCCCCCCCCC | 20.04 | 29654922 | |
109 | Sulfoxidation | DKGLEAAMKDIALIT CHHHHHHHHHHHHHH | 5.30 | 25693801 | |
239 | Phosphorylation | FREGGGGSTGAIVRK CCCCCCCCCCCEEEH | 27.26 | 28295753 | |
240 | Phosphorylation | REGGGGSTGAIVRKK CCCCCCCCCCEEEHH | 33.63 | 28295753 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RK5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RK5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RK5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RK5_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...