RK5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RK5_ARATH
• UniProt AC: O04603
• Protein Name: 50S ribosomal protein L5, chloroplastic
• Gene Name: RPL5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 262
• Subcellular Localization: Plastid, chloroplast.
• Protein Description: Binds 5S rRNA, forms part of the central protuberance of the 50S subunit..
• Protein Sequence: MASPSLLQSSASSFHGRFSPLAAPSSARMLSPPLRNVVKVSASGTVLVEKSEAEKTQRLKTAYLERIIPALKEEFKYVNIHQVPKVQKIVVNCGIGDAAQNDKGLEAAMKDIALITGQKPIKTRARASIATFKIREDQPLGIAVTLRGDVMYSFLDRLINLALPRTRDFQGVSPSSFDGNGNYSIGVKDQGVFPEIRFDAVGKTRGMDVCISTTAKSDQEGQKLLALMGMPFREGGGGSTGAIVRKKKLKSHHFDAKGKGKR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	SSFHGRFSPLAAPSS HHCCCCCCCCCCCCC	20.04	29654922
109	Sulfoxidation	DKGLEAAMKDIALIT CHHHHHHHHHHHHHH	5.30	25693801
239	Phosphorylation	FREGGGGSTGAIVRK CCCCCCCCCCCEEEH	27.26	28295753
240	Phosphorylation	REGGGGSTGAIVRKK CCCCCCCCCCEEEHH	33.63	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RK5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RK5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RK5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RK5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.