UniProt ID | RK4_ARATH | |
---|---|---|
UniProt AC | O50061 | |
Protein Name | 50S ribosomal protein L4, chloroplastic | |
Gene Name | RPL4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 282 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | This protein binds directly and specifically to 23S rRNA (By similarity). May play a role in plastid transcriptional regulation.. | |
Protein Sequence | MASSATAPNSLSFFSSSLFLSSSHQIPKTYISVSKLGSGRVSKPLSVSSQLATLPILSFEGEKVGETYLDLKAAPEDTARAVVHRAIVTDLNNKRRGTASTLTRGEVRGGGIKPYSQKKTGHARRGSQRTPLRPGGGVVFGPRPKDWSIKINRKEKKLAISTALSSAASAEGGAIVVEEFGEKFEKPKTKDFLAAMQRWGLDPKEKAMFLMIDVDENVAKSSRNIGTLRMLTPRTLNLFDILNADKLVLTPAAVEFLNARYGVDAVEEEDDDEDETEGSEEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
98 | Phosphorylation | LNNKRRGTASTLTRG CCCCCCCCCCCCCCC | 18.67 | 25561503 | |
161 | Phosphorylation | KEKKLAISTALSSAA HHHHHHHHHHHHHHH | 11.30 | 29654922 | |
165 | Phosphorylation | LAISTALSSAASAEG HHHHHHHHHHHHCCC | 18.57 | 26091701 | |
166 | Phosphorylation | AISTALSSAASAEGG HHHHHHHHHHHCCCC | 28.80 | 26091701 | |
261 | Phosphorylation | VEFLNARYGVDAVEE HHHHHHHHCCCCCCC | 21.06 | 29797451 | |
276 | Phosphorylation | EDDDEDETEGSEEA- CCCCCCCCCCCCCC- | 58.95 | 23776212 | |
279 | Phosphorylation | DEDETEGSEEA---- CCCCCCCCCCC---- | 26.49 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RK4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RK4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RK4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RK4_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-279, AND MASSSPECTROMETRY. |