UniProt ID | RK3A_ARATH | |
---|---|---|
UniProt AC | Q9SKX4 | |
Protein Name | 50S ribosomal protein L3-1, chloroplastic | |
Gene Name | RPL3A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 271 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.. | |
Protein Sequence | MAIAMAVVSFPSLLNKTTLSSSLFTPTFLPAKSSSLLIKSSPKTRFVVSSSMEAGIGVMGSKLGMMSFFEEDGTVVPVTVVGFREGNIVTQIKTLATDGYDAVQIGYRRVRDKKLTKPETGHLQKAGTIPMRHLQEFRLTNIEGFEPNQKLVFDEIFKEGDLVDVAGTTIGKGFQGGIKRHHFKRGQMTHGSKSHRALGSIGAGTTPGRVYKGKKMPGRMGGTRTKIRKLKIVKVDKELNVVMIKGALPGKPGNLLRITPAKIVGVNIPKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | FPSLLNKTTLSSSLF CHHHCCCCCCCCCCC | 31.71 | 28295753 | |
18 | Phosphorylation | PSLLNKTTLSSSLFT HHHCCCCCCCCCCCC | 26.67 | 28295753 | |
20 | Phosphorylation | LLNKTTLSSSLFTPT HCCCCCCCCCCCCCC | 18.78 | 28295753 | |
21 | Phosphorylation | LNKTTLSSSLFTPTF CCCCCCCCCCCCCCC | 33.89 | 28295753 | |
22 | Phosphorylation | NKTTLSSSLFTPTFL CCCCCCCCCCCCCCC | 24.91 | 28295753 | |
27 | Phosphorylation | SSSLFTPTFLPAKSS CCCCCCCCCCCCCCC | 34.44 | 28295753 | |
168 | Phosphorylation | DLVDVAGTTIGKGFQ CEEEECCCCCCCCCC | 12.90 | 30291188 | |
188 | Sulfoxidation | HHFKRGQMTHGSKSH CEECCCCCCCCCCCC | 3.13 | 25693801 | |
200 | Phosphorylation | KSHRALGSIGAGTTP CCCCCCCCCCCCCCC | 20.78 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RK3A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RK3A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RK3A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RK3A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...