dbPTM

RK3A_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RK3A_ARATH
UniProt AC	Q9SKX4
Protein Name	50S ribosomal protein L3-1, chloroplastic
Gene Name	RPL3A
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	271
Subcellular Localization	Plastid, chloroplast .
Protein Description	One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit..
Protein Sequence	MAIAMAVVSFPSLLNKTTLSSSLFTPTFLPAKSSSLLIKSSPKTRFVVSSSMEAGIGVMGSKLGMMSFFEEDGTVVPVTVVGFREGNIVTQIKTLATDGYDAVQIGYRRVRDKKLTKPETGHLQKAGTIPMRHLQEFRLTNIEGFEPNQKLVFDEIFKEGDLVDVAGTTIGKGFQGGIKRHHFKRGQMTHGSKSHRALGSIGAGTTPGRVYKGKKMPGRMGGTRTKIRKLKIVKVDKELNVVMIKGALPGKPGNLLRITPAKIVGVNIPKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	FPSLLNKTTLSSSLF CHHHCCCCCCCCCCC	31.71	28295753
18	Phosphorylation	PSLLNKTTLSSSLFT HHHCCCCCCCCCCCC	26.67	28295753
20	Phosphorylation	LLNKTTLSSSLFTPT HCCCCCCCCCCCCCC	18.78	28295753
21	Phosphorylation	LNKTTLSSSLFTPTF CCCCCCCCCCCCCCC	33.89	28295753
22	Phosphorylation	NKTTLSSSLFTPTFL CCCCCCCCCCCCCCC	24.91	28295753
27	Phosphorylation	SSSLFTPTFLPAKSS CCCCCCCCCCCCCCC	34.44	28295753
168	Phosphorylation	DLVDVAGTTIGKGFQ CEEEECCCCCCCCCC	12.90	30291188
188	Sulfoxidation	HHFKRGQMTHGSKSH CEECCCCCCCCCCCC	3.13	25693801
200	Phosphorylation	KSHRALGSIGAGTTP CCCCCCCCCCCCCCC	20.78	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RK3A_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RK3A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RK3A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RK3A_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RK3A_ARATH

Related Literatures of Post-Translational Modification