UniProt ID | RK24_ARATH | |
---|---|---|
UniProt AC | P92959 | |
Protein Name | 50S ribosomal protein L24, chloroplastic | |
Gene Name | RPL24 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 198 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit (By similarity). Required for optimal plastid performance in terms of photosynthesis and growth. Required for the translation of plastid mRNAs. Plays a critical role in biosynthesis of thylakoid membrane proteins encoded by chloroplast genes. [PubMed: 22900828] | |
Protein Sequence | MATMSALQSSFTSLSLSPSSSFLGQRLISPISLSVTSPVKPAENPCLVLAKLKRWERKECKPNSLPILHKMHVKFGDTVKVISGRDKGKIGEVTKIFTHNSTIVIKDVNLKTKHMKSREEGEPGQIVKIEAPIHSSNVMLYSKEKDVVSRVGHKVLEDGQKVRYLIKTGELIDTIEKWKLLKEAKDKETTQVAVTSAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
98 | Phosphorylation | GEVTKIFTHNSTIVI EEEEEEEECCCEEEE | 24.50 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RK24_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RK24_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RK24_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RK24_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...