RK24_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RK24_ARATH
• UniProt AC: P92959
• Protein Name: 50S ribosomal protein L24, chloroplastic
• Gene Name: RPL24
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 198
• Subcellular Localization: Plastid, chloroplast .
• Protein Description: One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit (By similarity). Required for optimal plastid performance in terms of photosynthesis and growth. Required for the translation of plastid mRNAs. Plays a critical role in biosynthesis of thylakoid membrane proteins encoded by chloroplast genes. [PubMed: 22900828]
• Protein Sequence: MATMSALQSSFTSLSLSPSSSFLGQRLISPISLSVTSPVKPAENPCLVLAKLKRWERKECKPNSLPILHKMHVKFGDTVKVISGRDKGKIGEVTKIFTHNSTIVIKDVNLKTKHMKSREEGEPGQIVKIEAPIHSSNVMLYSKEKDVVSRVGHKVLEDGQKVRYLIKTGELIDTIEKWKLLKEAKDKETTQVAVTSAS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
98	Phosphorylation	GEVTKIFTHNSTIVI EEEEEEEECCCEEEE	24.50	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RK24_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RK24_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RK24_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RK24_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.