dbPTM

RK22_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RK22_ARATH
UniProt AC	P56795
Protein Name	50S ribosomal protein L22, chloroplastic
Gene Name	rpl22
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	160
Subcellular Localization	Plastid, chloroplast.
Protein Description	This protein binds specifically to 23S rRNA.; The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome..
Protein Sequence	MIKKRKKKSYTEVYALGQYISMSAHKARRVIDQIRGRSYEEALMILELMPYRGCYPIFKLVYSAAANASHNKGFKETNLVISKAEVNQGNTVKKLKPRARGRSYPIKRSTCHITIVLEDISFYQQYEEYLMYLKKPGCSNENRNLTCYDTYSSGGLWDKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RK22_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RK22_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RK22_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RK22_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RK22_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RK22_ARATH

Related Literatures of Post-Translational Modification