RK192_ARATH - dbPTM
RK192_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID RK192_ARATH
UniProt AC Q8RXX5
Protein Name 50S ribosomal protein L19-2, chloroplastic
Gene Name At5g47190
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 229
Subcellular Localization Plastid, chloroplast.
Protein Description Located at the 30S-50S ribosomal subunit interface and binds directly to 23S ribosomal RNA..
Protein Sequence MATSSHLLPQALHMIPRTPSFSSKNLGVSSILPRASSVNSRLSVSRVFLNHSSSNFGFAIDSKKRKEFIAKAEESTEGETEAVVENAVETEAEGEGEATVAAEEAKPPWKTRVKLGDIMGLLNKKAIEVAETVRPVPGLRTGDIVEIKLEVPENKRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of RK192_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of RK192_ARATH !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of RK192_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of RK192_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of RK192_ARATH !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of RK192_ARATH

loading...

Related Literatures of Post-Translational Modification

TOP