dbPTM

RK191_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RK191_ARATH
UniProt AC	Q8W463
Protein Name	50S ribosomal protein L19-1, chloroplastic
Gene Name	At4g17560
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	225
Subcellular Localization	Plastid, chloroplast.
Protein Description	Located at the 30S-50S ribosomal subunit interface and binds directly to 23S ribosomal RNA..
Protein Sequence	MAMSFHRLPQALHMIPRNPTQSSKNLGFSSFLSCAPSMDSRISVSRLSLNHPGSKFGFSLDTRVRNEFIVRAEEGNTEAESEEFVAEIADTEGNVEEVVEAKPTRKPRIKLGDVMGILNQKAIEVAEKVRPVPEIRTGDIVEIKLEVPENKRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
77	Phosphorylation	VRAEEGNTEAESEEF EEECCCCCHHHCHHH	47.64	23776212
81	Phosphorylation	EGNTEAESEEFVAEI CCCCHHHCHHHHHHH	49.85	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RK191_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RK191_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RK191_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RK191_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RK191_ARATH

Related Literatures of Post-Translational Modification