UniProt ID | RK17_ARATH | |
---|---|---|
UniProt AC | Q9M385 | |
Protein Name | 50S ribosomal protein L17, chloroplastic | |
Gene Name | RPL17 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 211 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | This protein binds directly to 23S ribosomal RNA.. | |
Protein Sequence | MAIPMSMAMATPTDSVSRVWSMSSLKSALPSTASLRLPSSSSRRPVTLRLPISSPSLPSFSGLSPVNPLLSIGLPDWQSFENGFKIVDGGGRIYAMRHGRRVPKLNRPPDQRKALLRGLTTQLLKHGRIKTTRARASAMRKFVDKMITLAKDGSLHKRRQALGYIYEKQIVHALFAEVPDRYGERNGGYTRIIRTLPRRGDNAPMAYIELV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MAIPMSMAMATPT --CCCCCCCCCCCCC | 9.68 | 28295753 | |
11 | Phosphorylation | PMSMAMATPTDSVSR CCCCCCCCCCCCHHH | 17.40 | 28295753 | |
13 | Phosphorylation | SMAMATPTDSVSRVW CCCCCCCCCCHHHHH | 36.23 | 28295753 | |
15 | Phosphorylation | AMATPTDSVSRVWSM CCCCCCCCHHHHHCH | 25.19 | 28295753 | |
17 | Phosphorylation | ATPTDSVSRVWSMSS CCCCCCHHHHHCHHH | 25.68 | 28295753 | |
21 | Phosphorylation | DSVSRVWSMSSLKSA CCHHHHHCHHHHHHH | 13.11 | 28295753 | |
23 | Phosphorylation | VSRVWSMSSLKSALP HHHHHCHHHHHHHCC | 27.31 | 28295753 | |
24 | Phosphorylation | SRVWSMSSLKSALPS HHHHCHHHHHHHCCC | 31.04 | 28295753 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RK17_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RK17_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RK17_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RK17_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...