RK17_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RK17_ARATH
• UniProt AC: Q9M385
• Protein Name: 50S ribosomal protein L17, chloroplastic
• Gene Name: RPL17
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 211
• Subcellular Localization: Plastid, chloroplast.
• Protein Description: This protein binds directly to 23S ribosomal RNA..
• Protein Sequence: MAIPMSMAMATPTDSVSRVWSMSSLKSALPSTASLRLPSSSSRRPVTLRLPISSPSLPSFSGLSPVNPLLSIGLPDWQSFENGFKIVDGGGRIYAMRHGRRVPKLNRPPDQRKALLRGLTTQLLKHGRIKTTRARASAMRKFVDKMITLAKDGSLHKRRQALGYIYEKQIVHALFAEVPDRYGERNGGYTRIIRTLPRRGDNAPMAYIELV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MAIPMSMAMATPT --CCCCCCCCCCCCC	9.68	28295753
11	Phosphorylation	PMSMAMATPTDSVSR CCCCCCCCCCCCHHH	17.40	28295753
13	Phosphorylation	SMAMATPTDSVSRVW CCCCCCCCCCHHHHH	36.23	28295753
15	Phosphorylation	AMATPTDSVSRVWSM CCCCCCCCHHHHHCH	25.19	28295753
17	Phosphorylation	ATPTDSVSRVWSMSS CCCCCCHHHHHCHHH	25.68	28295753
21	Phosphorylation	DSVSRVWSMSSLKSA CCHHHHHCHHHHHHH	13.11	28295753
23	Phosphorylation	VSRVWSMSSLKSALP HHHHHCHHHHHHHCC	27.31	28295753
24	Phosphorylation	SRVWSMSSLKSALPS HHHHCHHHHHHHCCC	31.04	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RK17_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RK17_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RK17_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RK17_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.