UniProt ID | RK15_ARATH | |
---|---|---|
UniProt AC | P25873 | |
Protein Name | 50S ribosomal protein L15, chloroplastic | |
Gene Name | RPL15 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 277 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | ||
Protein Sequence | MATPLSISSNPLTSRHCYRLHLSSTSFKGNVSVLGANPSQILSLKLNQTLKTRNQQQFARPLVVVSQTAATSSAVVAPERFRLDNLGPQPGSRKKQKRKGRGISAGQGASCGFGMRGQKSRSGPGIMRGFEGGQTALYRRLPKLRGIAGGMRSGLPKYLPVNIKDIETAGFQEGDEVSLETLKQKGLINPSGRERKLPLKILGTGELSMKLTFKARAFSTQAKEKLEASGCTLTVLPGRKKWVKPSVAKNQARADEYFAKKRAAAAEAATSEPAASA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | SISSNPLTSRHCYRL CCCCCCCCCCCEEEE | 25.60 | 19880383 | |
68 | Acetylation | PLVVVSQTAATSSAV CEEEEECCCCCCCCE | 15.68 | 22223895 | |
68 | O-linked_Glycosylation | PLVVVSQTAATSSAV CEEEEECCCCCCCCE | 15.68 | 18431481 | |
73 | Phosphorylation | SQTAATSSAVVAPER ECCCCCCCCEECCHH | 22.26 | 29654922 | |
208 | Phosphorylation | ILGTGELSMKLTFKA EECCCCCEEEEEEEE | 15.01 | 25561503 | |
209 | Sulfoxidation | LGTGELSMKLTFKAR ECCCCCEEEEEEEEE | 6.88 | 25693801 | |
270 | Phosphorylation | AAAAEAATSEPAASA HHHHHHHHCCCCCCC | 40.44 | 28295753 | |
271 | Phosphorylation | AAAEAATSEPAASA- HHHHHHHCCCCCCC- | 36.54 | 29654922 | |
276 | Phosphorylation | ATSEPAASA------ HHCCCCCCC------ | 36.30 | 29654922 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RK15_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RK15_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RK15_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RK15_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...