UniProt ID | RK123_ARATH | |
---|---|---|
UniProt AC | P36212 | |
Protein Name | 50S ribosomal protein L12-3, chloroplastic | |
Gene Name | RPL12C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 187 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | ||
Protein Sequence | MASTTLSIATTIRSSSPLTSASTHHFLSKPTAIEFPFRLSSSSSHRAINLRPISAVEAPEKIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEFDVVINEVPSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEEAGAKVSIA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MASTTLSIATT ----CCCCEEEHHHH | 23.40 | 19880383 | |
10 | Phosphorylation | STTLSIATTIRSSSP CCEEEHHHHHCCCCC | 22.53 | 19880383 | |
11 | Phosphorylation | TTLSIATTIRSSSPL CEEEHHHHHCCCCCC | 12.84 | 19880383 | |
67 | Phosphorylation | EKIEKIGSEISSLTL HHHHHHCHHHHHCCH | 34.92 | 30291188 | |
71 | Phosphorylation | KIGSEISSLTLEEAR HHCHHHHHCCHHHHH | 30.91 | 30291188 | |
143 | Phosphorylation | IKAVRALTSLALKEA HHHHHHHHHHHHHHH | 22.25 | 25561503 | |
144 | Phosphorylation | KAVRALTSLALKEAK HHHHHHHHHHHHHHH | 16.70 | 25561503 | |
185 | Phosphorylation | EEAGAKVSIA----- HHHCCCCCCC----- | 16.46 | 29797451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RK123_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RK123_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RK123_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RK123_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...