RK123_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RK123_ARATH
• UniProt AC: P36212
• Protein Name: 50S ribosomal protein L12-3, chloroplastic
• Gene Name: RPL12C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 187
• Subcellular Localization: Plastid, chloroplast.
• Protein Sequence: MASTTLSIATTIRSSSPLTSASTHHFLSKPTAIEFPFRLSSSSSHRAINLRPISAVEAPEKIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEFDVVINEVPSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEEAGAKVSIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MASTTLSIATT ----CCCCEEEHHHH	23.40	19880383
10	Phosphorylation	STTLSIATTIRSSSP CCEEEHHHHHCCCCC	22.53	19880383
11	Phosphorylation	TTLSIATTIRSSSPL CEEEHHHHHCCCCCC	12.84	19880383
67	Phosphorylation	EKIEKIGSEISSLTL HHHHHHCHHHHHCCH	34.92	30291188
71	Phosphorylation	KIGSEISSLTLEEAR HHCHHHHHCCHHHHH	30.91	30291188
143	Phosphorylation	IKAVRALTSLALKEA HHHHHHHHHHHHHHH	22.25	25561503
144	Phosphorylation	KAVRALTSLALKEAK HHHHHHHHHHHHHHH	16.70	25561503
185	Phosphorylation	EEAGAKVSIA----- HHHCCCCCCC-----	16.46	29797451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RK123_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RK123_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RK123_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RK123_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.