dbPTM

RK11_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RK11_ARATH
UniProt AC	Q9MAP3
Protein Name	50S ribosomal protein L11, chloroplastic
Gene Name	RPL11
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	222
Subcellular Localization	Plastid, chloroplast .
Protein Description	Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors..
Protein Sequence	MASSSLSTLCSSTSSSLHPNSKLSHSLSAKLSSKANVSVQFLGKKQSPLLSSTPRFLTVIAMAPPKPGGKAKKVVGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKAGYIIPVEITVFDDKSFTFILKTPPASVLLLKAAGVEKGSKDPQQDKVGVITIDQLRTIAAEKLPDLNCTTIESAMRIIAGTAANMGIDIDPPILEPKKKAVLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
99	Phosphorylation	PVGPALGSKGVNIMA CCCCCCCCCCCEEEE	27.38	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RK11_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RK11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RK11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RK11_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RK11_ARATH

Related Literatures of Post-Translational Modification