dbPTM

RIT2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIT2_MOUSE
UniProt AC	P70425
Protein Name	GTP-binding protein Rit2
Gene Name	Rit2
Organism	Mus musculus (Mouse).
Sequence Length	217
Subcellular Localization	Nucleus . Cell membrane . Colocalizes with PLXNB3 at the plasma membrane.
Protein Description	Binds and exchanges GTP and GDP. Binds and modulates the activation of POU4F1 as gene expression regulator..
Protein Sequence	MEVENEAHCCPGSSSGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGMNLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLKKKRENML

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
10	S-palmitoylation	VENEAHCCPGSSSGG CCCCCCCCCCCCCCC	2.84	28680068
200	Phosphorylation	RKLKRKDSLWKKIKA HHHCCCHHHHHHHHH	38.88	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIT2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIT2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIT2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RIT2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIT2_MOUSE

Related Literatures of Post-Translational Modification