dbPTM

RIR2_HHV11 - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIR2_HHV11
UniProt AC	P10224
Protein Name	Ribonucleoside-diphosphate reductase small subunit {ECO:0000255\|HAMAP-Rule:MF_04028}
Gene Name	RIR2 {ECO:0000255\|HAMAP-Rule:MF_04028}
Organism	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1).
Sequence Length	340
Subcellular Localization	Host membrane Single-pass membrane protein .
Protein Description	Ribonucleoside-diphosphate reductase holoenzyme provides the precursors necessary for viral DNA synthesis. Allows virus growth in non-dividing cells, as well as reactivation from latency in infected hosts. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides..
Protein Sequence	MDSAAPALSPALTALTDQSATADLAIQIPKCPDPERYFYTSQCPDINHLRSLSILNRWLETELVFVGDEEDVSKLSEGELSFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECIEVVHSRVYNIIQLVLFHNNDQARREYVAGTINHPAIRAKVDWLEARVRECASVPEKFILMILIEGIFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPPPDRVYGLFRQAVEIEIGFIRSQAPTDSHILSPAALAAIENYVRFSADRLLGLIHMKPLFSAPPPDASFPLSLMSTDKHTNFFECRSTSYAGAVVNDL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RIR2_HHV11 !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIR2_HHV11 !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIR2_HHV11 !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIR2_HHV11 !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RIR2_HHV11 !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIR2_HHV11

Related Literatures of Post-Translational Modification