UniProt ID | RIR2_HHV11 | |
---|---|---|
UniProt AC | P10224 | |
Protein Name | Ribonucleoside-diphosphate reductase small subunit {ECO:0000255|HAMAP-Rule:MF_04028} | |
Gene Name | RIR2 {ECO:0000255|HAMAP-Rule:MF_04028} | |
Organism | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1). | |
Sequence Length | 340 | |
Subcellular Localization |
Host membrane Single-pass membrane protein . |
|
Protein Description | Ribonucleoside-diphosphate reductase holoenzyme provides the precursors necessary for viral DNA synthesis. Allows virus growth in non-dividing cells, as well as reactivation from latency in infected hosts. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.. | |
Protein Sequence | MDSAAPALSPALTALTDQSATADLAIQIPKCPDPERYFYTSQCPDINHLRSLSILNRWLETELVFVGDEEDVSKLSEGELSFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECIEVVHSRVYNIIQLVLFHNNDQARREYVAGTINHPAIRAKVDWLEARVRECASVPEKFILMILIEGIFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPPPDRVYGLFRQAVEIEIGFIRSQAPTDSHILSPAALAAIENYVRFSADRLLGLIHMKPLFSAPPPDASFPLSLMSTDKHTNFFECRSTSYAGAVVNDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RIR2_HHV11 !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIR2_HHV11 !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIR2_HHV11 !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIR2_HHV11 !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RIR2_HHV11 !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...