RIR2_HHV11 - dbPTM
RIR2_HHV11 - PTM Information in dbPTM
Basic Information of Protein
UniProt ID RIR2_HHV11
UniProt AC P10224
Protein Name Ribonucleoside-diphosphate reductase small subunit {ECO:0000255|HAMAP-Rule:MF_04028}
Gene Name RIR2 {ECO:0000255|HAMAP-Rule:MF_04028}
Organism Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1).
Sequence Length 340
Subcellular Localization Host membrane
Single-pass membrane protein .
Protein Description Ribonucleoside-diphosphate reductase holoenzyme provides the precursors necessary for viral DNA synthesis. Allows virus growth in non-dividing cells, as well as reactivation from latency in infected hosts. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides..
Protein Sequence MDSAAPALSPALTALTDQSATADLAIQIPKCPDPERYFYTSQCPDINHLRSLSILNRWLETELVFVGDEEDVSKLSEGELSFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECIEVVHSRVYNIIQLVLFHNNDQARREYVAGTINHPAIRAKVDWLEARVRECASVPEKFILMILIEGIFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPPPDRVYGLFRQAVEIEIGFIRSQAPTDSHILSPAALAAIENYVRFSADRLLGLIHMKPLFSAPPPDASFPLSLMSTDKHTNFFECRSTSYAGAVVNDL
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of RIR2_HHV11 !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of RIR2_HHV11 !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of RIR2_HHV11 !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of RIR2_HHV11 !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of RIR2_HHV11 !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of RIR2_HHV11

loading...

Related Literatures of Post-Translational Modification

TOP