dbPTM

RIR2C_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIR2C_ARATH
UniProt AC	Q9LSD0
Protein Name	Ribonucleoside-diphosphate reductase small chain C
Gene Name	TSO2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	332
Subcellular Localization	Cytoplasm . Nucleus . Cytoplasmic in adult cells, and nuclear in meristematic regions and in all tissues following DNA damage. The nuclear exclusion is dependent on CSN7.
Protein Description	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Involved in DNA damage repair and programmed cell death inhibition..
Protein Sequence	MPSMPEEPLLTPTPDRFCMFPIHYPQIWEMYKKAEASFWTAEEVDLSQDNRDWENSLNDGERHFIKHVLAFFAASDGIVLENLASRFMSDVQVSEARAFYGFQIAIENIHSEMYSLLLDTYIKDNKERDHLFRAIETIPCVAKKAQWAMKWIDGSQTFAERIIAFACVEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYTLLKTKLSEERVKSIVCDAVEIEREFVCDALPCALVGMNRDLMSQYIEFVADRLLGALGYGKVYGVTNPFDWMELISLQGKTNFFEKRVGDYQKASVMSSVNGNGAFDNHVFSLDEDF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RIR2C_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIR2C_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIR2C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIR2C_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RIR2C_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIR2C_ARATH

Related Literatures of Post-Translational Modification