UniProt ID | RIR2A_ARATH | |
---|---|---|
UniProt AC | P50651 | |
Protein Name | Ribonucleoside-diphosphate reductase small chain A | |
Gene Name | RNR2A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 341 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.. | |
Protein Sequence | MGSLKEGQGRDMEEGESEEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEALTDSEKHFISHILAFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFIKDSKEKDRLFNAIETIPCISKKAKWCLDWIQSPMSFAVRLVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPLEKVYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYKAENPFDWMEFISLQGKTNFFEKRVGEYQKASVMSNLQNGNQNYEFTTEEDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
111 | Phosphorylation | VPEARAFYGFQIAME CCHHHHHHCHHHHHH | 18.95 | 28295753 | |
122 | Phosphorylation | IAMENIHSEMYSLLL HHHHHHHHHHHHHHH | 21.91 | 28295753 | |
125 | Phosphorylation | ENIHSEMYSLLLETF HHHHHHHHHHHHHHH | 7.66 | 28295753 | |
126 | Phosphorylation | NIHSEMYSLLLETFI HHHHHHHHHHHHHHH | 15.95 | 28295753 | |
131 | Phosphorylation | MYSLLLETFIKDSKE HHHHHHHHHHCCHHH | 30.54 | 28295753 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIR2A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIR2A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIR2A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CSN7_ARATH | FUS5 | physical | 21614643 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...