dbPTM

RIR2A_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIR2A_ARATH
UniProt AC	P50651
Protein Name	Ribonucleoside-diphosphate reductase small chain A
Gene Name	RNR2A
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	341
Subcellular Localization	Cytoplasm.
Protein Description	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides..
Protein Sequence	MGSLKEGQGRDMEEGESEEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEALTDSEKHFISHILAFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFIKDSKEKDRLFNAIETIPCISKKAKWCLDWIQSPMSFAVRLVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPLEKVYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYKAENPFDWMEFISLQGKTNFFEKRVGEYQKASVMSNLQNGNQNYEFTTEEDF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
111	Phosphorylation	VPEARAFYGFQIAME CCHHHHHHCHHHHHH	18.95	28295753
122	Phosphorylation	IAMENIHSEMYSLLL HHHHHHHHHHHHHHH	21.91	28295753
125	Phosphorylation	ENIHSEMYSLLLETF HHHHHHHHHHHHHHH	7.66	28295753
126	Phosphorylation	NIHSEMYSLLLETFI HHHHHHHHHHHHHHH	15.95	28295753
131	Phosphorylation	MYSLLLETFIKDSKE HHHHHHHHHHCCHHH	30.54	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIR2A_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIR2A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIR2A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CSN7_ARATH	FUS5	physical	21614643

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIR2A_ARATH

Related Literatures of Post-Translational Modification