UniProt ID | RIM1_SCHPO | |
---|---|---|
UniProt AC | O14087 | |
Protein Name | Single-stranded DNA-binding protein rim1, mitochondrial | |
Gene Name | rim1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 150 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | This protein binds preferentially and cooperatively to ss-DNA. Involved in mitochondrial DNA replication (By similarity).. | |
Protein Sequence | MLFLKSSRAFSKRLFSSSTVRYRDIQRLTLTGNLTKDVERLQSQKGNEYMRYTVASNNGKDVAPTFHSVYVFDSYNFDRLQTILRKGTRVYVEADAVWRSVPAGNEGSQAKMSLRHVSADVLFYPRNKNGDESGEETHPELDADPMINSF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
133 | Phosphorylation | RNKNGDESGEETHPE CCCCCCCCCCCCCCC | 57.13 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIM1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIM1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIM1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD22_SCHPO | rad52 | physical | 23779158 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...