UniProt ID | RHOV_HUMAN | |
---|---|---|
UniProt AC | Q96L33 | |
Protein Name | Rho-related GTP-binding protein RhoV | |
Gene Name | RHOV {ECO:0000312|HGNC:HGNC:18313} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Endosome membrane Lipid-anchor Cytoplasmic side . Treatment with TNF activates endosomal but not plasma membrane RHOV. |
|
Protein Description | Plays a role in the control of the actin cytoskeleton via activation of the JNK pathway.. | |
Protein Sequence | MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | PPPLRAPTPPPRRRS CCCCCCCCCCCCCCC | 47.66 | 23186163 | |
25 | Phosphorylation | TPPPRRRSAPPELGI CCCCCCCCCCCCCCC | 43.23 | 25159151 | |
33 | Ubiquitination | APPELGIKCVLVGDG CCCCCCCEEEEECCC | 19.25 | - | |
177 | Ubiquitination | QAQGLAEKIRACCYL HHHHHHHHHHHHHHH | 31.70 | - | |
192 | Ubiquitination | ECSALTQKNLKEVFD HCHHHCHHCHHHHHH | 60.04 | - | |
195 | Ubiquitination | ALTQKNLKEVFDSAI HHCHHCHHHHHHHHH | 62.31 | - | |
209 | Ubiquitination | ILSAIEHKARLEKKL HHHHHHHHHHHHHHH | 23.55 | - | |
234 | S-palmitoylation | CRWKKFFCFV----- CCEEEEEEEC----- | 3.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOV_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOV_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOV_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RHOV_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...