UniProt ID | RHOJ_MOUSE | |
---|---|---|
UniProt AC | Q9ER71 | |
Protein Name | Rho-related GTP-binding protein RhoJ | |
Gene Name | Rhoj | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 214 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | GTP-binding protein with GTPase activity. Elicits the formation of F-actin-rich structures in fibroblasts and is involved in the regulation of cell morphology.. | |
Protein Sequence | MSCRERTDSSCGCNGHEENRILKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKGCLGCHGCCAII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | S-palmitoylation | -----MSCRERTDSS -----CCCCCCCCCC | 5.17 | - | |
7 | Phosphorylation | -MSCRERTDSSCGCN -CCCCCCCCCCCCCC | 35.16 | 29550500 | |
9 | Phosphorylation | SCRERTDSSCGCNGH CCCCCCCCCCCCCCC | 27.24 | 23684622 | |
10 | Phosphorylation | CRERTDSSCGCNGHE CCCCCCCCCCCCCCC | 19.82 | 23140645 | |
11 | S-palmitoylation | RERTDSSCGCNGHEE CCCCCCCCCCCCCCC | 9.25 | - | |
211 | Methylation | CLGCHGCCAII---- CCCCCCCEEEC---- | 3.45 | - | |
211 | Farnesylation | CLGCHGCCAII---- CCCCCCCEEEC---- | 3.45 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOJ_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOJ_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOJ_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RHOJ_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...