RHOH_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RHOH_MOUSE
• UniProt AC: Q9D3G9
• Protein Name: Rho-related GTP-binding protein RhoH
• Gene Name: Rhoh
• Organism: Mus musculus (Mouse).
• Sequence Length: 191
• Subcellular Localization: Cytoplasm . Cell membrane ; Lipid-anchor ; Cytoplasmic side . Colocalizes together with ZAP70 in the immunological synapse.
• Protein Description: Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. Inhibits the activation of NF-kappa-B by TNF and IKKB and the activation of CRK/p38 by TNF. Inhibits activities of RAC1, RHOA and CDC42. Negatively regulates leukotriene production in neutrophils (By similarity). Negative regulator of hematopoietic progenitor cell proliferation, survival and migration. Critical regulator of thymocyte development and T-cell antigen receptor (TCR) signaling by mediating recruitment and activation of ZAP70. Required for phosphorylation of CD3Z, membrane translocation of ZAP70 and subsequent activation of the ZAP70-mediated pathways. Essential for efficient beta-selection and positive selection by promoting the ZAP70-dependent phosphorylation of the LAT signalosome during pre-TCR and TCR signaling. Crucial for thymocyte maturation during DN3 to DN4 transition and during positive selection. Plays critical roles in mast cell function by facilitating phosphorylation of SYK in Fc epsilon RI-mediated signal transduction. Essential for the phosphorylation of LAT, LCP2, PLCG1 and PLCG2 and for Ca(2+) mobilization in mast cells..
• Protein Sequence: MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWISEIRSNLPCTPVLVVATQTDQREVGPHRASCINAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRKLFSINECKIF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	GDSAVGKTSLLVRFT CCCCCCCEEEEEEEC	20.76	-
100	Phosphorylation	NLKNKWISEIRSNLP HCCHHHHHHHHHCCC	26.34	28059163
188	Methylation	KLFSINECKIF---- HCEECCCCCCC----	3.37	-
188	Geranylgeranylation	KLFSINECKIF---- HCEECCCCCCC----	3.37	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RHOH_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RHOH_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RHOH_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RHOH_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.