| UniProt ID | RHOH_HUMAN | |
|---|---|---|
| UniProt AC | Q15669 | |
| Protein Name | Rho-related GTP-binding protein RhoH | |
| Gene Name | RHOH | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 191 | |
| Subcellular Localization |
Cytoplasm . Cell membrane Lipid-anchor Cytoplasmic side. Colocalizes together with ZAP70 in the immunological synapse.. |
|
| Protein Description | Negative regulator of hematopoietic progenitor cell proliferation, survival and migration. Critical regulator of thymocyte development and T-cell antigen receptor (TCR) signaling by mediating recruitment and activation of ZAP70. Required for phosphorylation of CD3Z, membrane translocation of ZAP70 and subsequent activation of the ZAP70-mediated pathways. Essential for efficient beta-selection and positive selection by promoting the ZAP70-dependent phosphorylation of the LAT signalosome during pre-TCR and TCR signaling. Crucial for thymocyte maturation during DN3 to DN4 transition and during positive selection. Plays critical roles in mast cell function by facilitating phosphorylation of SYK in Fc epsilon RI-mediated signal transduction. Essential for the phosphorylation of LAT, LCP2, PLCG1 and PLCG2 and for Ca(2+) mobilization in mast cells (By similarity). Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. Inhibits the activation of NF-kappa-B by TNF and IKKB and the activation of CRK/p38 by TNF. Inhibits activities of RAC1, RHOA and CDC42. Negatively regulates leukotriene production in neutrophils.. | |
| Protein Sequence | MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MLSSIKCVLV -----CCCCCEEEEE | 28.81 | 24719451 | |
| 6 | Ubiquitination | --MLSSIKCVLVGDS --CCCCCEEEEECCC | 21.90 | - | |
| 13 | Phosphorylation | KCVLVGDSAVGKTSL EEEEECCCCCCCEEE | 20.94 | - | |
| 17 | Ubiquitination | VGDSAVGKTSLLVRF ECCCCCCCEEEEEEE | 28.48 | - | |
| 53 | Phosphorylation | FMDGIQISLGLWDTA EECCEEEEEECCCCC | 10.46 | 22210691 | |
| 67 | Phosphorylation | AGNDAFRSIRPLSYQ CCCHHHHHCCCCCHH | 19.25 | 22210691 | |
| 72 | Phosphorylation | FRSIRPLSYQQADVV HHHCCCCCHHCCCEE | 24.47 | 23663014 | |
| 73 | Phosphorylation | RSIRPLSYQQADVVL HHCCCCCHHCCCEEE | 16.60 | 23663014 | |
| 83 | Phosphorylation | ADVVLMCYSVANHNS CCEEEEEEECCCCCH | 7.69 | 23663014 | |
| 84 | Phosphorylation | DVVLMCYSVANHNSF CEEEEEEECCCCCHH | 15.15 | 23663014 | |
| 90 | Phosphorylation | YSVANHNSFLNLKNK EECCCCCHHHHCCCC | 24.45 | 23663014 | |
| 97 | Ubiquitination | SFLNLKNKWIGEIRS HHHHCCCCHHHHHHH | 38.30 | - | |
| 137 | Ubiquitination | CVNAMEGKKLAQDVR HHHHHCHHHHHHHHH | 31.16 | - | |
| 138 | Ubiquitination | VNAMEGKKLAQDVRA HHHHCHHHHHHHHHH | 60.97 | - | |
| 146 | Ubiquitination | LAQDVRAKGYLECSA HHHHHHHCCCEEHHH | 37.21 | - | |
| 188 | Methylation | RLFSINECKIF---- HCEECCCCCCC---- | 3.37 | - | |
| 188 | Geranylgeranylation | RLFSINECKIF---- HCEECCCCCCC---- | 3.37 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOH_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOH_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOH_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
| UT14A_HUMAN | UTP14A | physical | 16169070 | |
| GDIR1_HUMAN | ARHGDIA | physical | 11809807 | |
| GDIR2_HUMAN | ARHGDIB | physical | 11809807 | |
| GDIR3_HUMAN | ARHGDIG | physical | 11809807 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...