| UniProt ID | RHOG_MOUSE | |
|---|---|---|
| UniProt AC | P84096 | |
| Protein Name | Rho-related GTP-binding protein RhoG | |
| Gene Name | Rhog | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 191 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes (By similarity).. | |
| Protein Sequence | MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 32 | Phosphorylation | TNAFPKEYIPTVFDN CCCCCHHHCCCCCCC | 20.51 | 29514104 | |
| 35 | Phosphorylation | FPKEYIPTVFDNYSA CCHHHCCCCCCCCCC | 25.01 | 28285833 | |
| 64 | Phosphorylation | DTAGQEEYDRLRTLS CCCCHHHHHHHHHCC | 12.95 | 29514104 | |
| 105 | S-nitrosocysteine | HPEVCHHCPDVPILL CHHHHHCCCCCCEEE | 1.05 | - | |
| 105 | S-nitrosylation | HPEVCHHCPDVPILL CHHHHHCCCCCCEEE | 1.05 | 20925432 | |
| 125 | Phosphorylation | DLRAQPDTLRRLKEQ HHHCCHHHHHHHHHC | 28.93 | 29514104 | |
| 130 | Ubiquitination | PDTLRRLKEQGQAPI HHHHHHHHHCCCCCC | 46.29 | 22790023 | |
| 138 | Phosphorylation | EQGQAPITPQQGQAL HCCCCCCCHHHHHHH | 17.62 | - | |
| 147 | Ubiquitination | QQGQALAKQIHAVRY HHHHHHHHHHHHHHH | 51.11 | 22790023 | |
| 166 | Ubiquitination | ALQQDGVKEVFAEAV HHCCCCHHHHHHHHH | 54.40 | 22790023 | |
| 180 | Phosphorylation | VRAVLNPTPIKRGRS HHHHHCCCCCCCCCC | 36.25 | 28066266 | |
| 183 | Ubiquitination | VLNPTPIKRGRSCIL HHCCCCCCCCCCEEE | 50.43 | 22790023 | |
| 188 | Methylation | PIKRGRSCILL---- CCCCCCCEEEC---- | 2.15 | - | |
| 188 | Geranylgeranylation | PIKRGRSCILL---- CCCCCCCEEEC---- | 2.15 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOG_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOG_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOG_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RHOG_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
