UniProt ID | RHOG_MOUSE | |
---|---|---|
UniProt AC | P84096 | |
Protein Name | Rho-related GTP-binding protein RhoG | |
Gene Name | Rhog | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 191 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes (By similarity).. | |
Protein Sequence | MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | TNAFPKEYIPTVFDN CCCCCHHHCCCCCCC | 20.51 | 29514104 | |
35 | Phosphorylation | FPKEYIPTVFDNYSA CCHHHCCCCCCCCCC | 25.01 | 28285833 | |
64 | Phosphorylation | DTAGQEEYDRLRTLS CCCCHHHHHHHHHCC | 12.95 | 29514104 | |
105 | S-nitrosocysteine | HPEVCHHCPDVPILL CHHHHHCCCCCCEEE | 1.05 | - | |
105 | S-nitrosylation | HPEVCHHCPDVPILL CHHHHHCCCCCCEEE | 1.05 | 20925432 | |
125 | Phosphorylation | DLRAQPDTLRRLKEQ HHHCCHHHHHHHHHC | 28.93 | 29514104 | |
130 | Ubiquitination | PDTLRRLKEQGQAPI HHHHHHHHHCCCCCC | 46.29 | 22790023 | |
138 | Phosphorylation | EQGQAPITPQQGQAL HCCCCCCCHHHHHHH | 17.62 | - | |
147 | Ubiquitination | QQGQALAKQIHAVRY HHHHHHHHHHHHHHH | 51.11 | 22790023 | |
166 | Ubiquitination | ALQQDGVKEVFAEAV HHCCCCHHHHHHHHH | 54.40 | 22790023 | |
180 | Phosphorylation | VRAVLNPTPIKRGRS HHHHHCCCCCCCCCC | 36.25 | 28066266 | |
183 | Ubiquitination | VLNPTPIKRGRSCIL HHCCCCCCCCCCEEE | 50.43 | 22790023 | |
188 | Methylation | PIKRGRSCILL---- CCCCCCCEEEC---- | 2.15 | - | |
188 | Geranylgeranylation | PIKRGRSCILL---- CCCCCCCEEEC---- | 2.15 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOG_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOG_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOG_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RHOG_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...