| UniProt ID | RHOD_MOUSE | |
|---|---|---|
| UniProt AC | P97348 | |
| Protein Name | Rho-related GTP-binding protein RhoD | |
| Gene Name | Rhod | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 210 | |
| Subcellular Localization | Cell membrane. Early endosome . Colocalizes with RAB5 to early endosomes. | |
| Protein Description | Involved in endosome dynamics. May coordinate membrane transport with the function of the cytoskeleton. Involved in the internalization and trafficking of activated tyrosine kinase receptors such as PDGFRB. Participates in the reorganization of actin cytoskeleton; the function seems to involve WHAMM and includes regulation of filopodia formation and actin filament bundling. Can modulate the effect of DAPK3 in reorganization of actin cytoskeleton and focal adhesion dissolution.. | |
| Protein Sequence | MNASQVAGEEAPQSGHSVKVVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVALSSRRHNFWRRITQNCCLAT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 45 | Phosphorylation | AKGAFPESYSPTVFE CCCCCCCCCCCCHHH | 31.02 | 28066266 | |
| 46 | Phosphorylation | KGAFPESYSPTVFER CCCCCCCCCCCHHHH | 19.60 | 29514104 | |
| 47 | Phosphorylation | GAFPESYSPTVFERY CCCCCCCCCCHHHHH | 24.31 | 26824392 | |
| 49 | Phosphorylation | FPESYSPTVFERYNA CCCCCCCCHHHHHCE | 31.70 | 23984901 | |
| 78 | Phosphorylation | DTAGQDDYDRLRPLF ECCCCCCHHHCHHHC | 15.97 | 29514104 | |
| 137 | Ubiquitination | KIDLRKDKVLVNNLR ECCCCCCHHHHHCCH | 40.27 | 22790023 | |
| 207 | Methylation | RRITQNCCLAT---- HHHHHCCCCCC---- | 3.67 | - | |
| 207 | Geranylgeranylation | RRITQNCCLAT---- HHHHHCCCCCC---- | 3.67 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOD_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOD_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOD_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RHOD_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
